This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Boster
product type :
protein
product name :
Recombinant Human FGF2 Protein
catalog :
R00121
quantity :
100µg/vial
product information
SKU :
R00121
Product Name :
Recombinant Human FGF2 Protein
Product Page URL :
https://www.bosterbio.comrecombinant-human-fgf2-protein-r00121-boster.html
Gene Name :
FGF2
Size :
100µg/vial
Reactivity :
Human
Description :
Fibroblast Growth Factor basic (FGF-basic/FGF-2) is a single-chain polypeptide growth factor that plays a significant role in the process of wound healing and is a potent inducer of angiogenesis. Several different forms of the human protein exist ranging from 18-24 kDa in size due to the use of alternative start sites within the fgf-2 gene. It has a 55 percent amino acid residue identity to FGF-1 and has potent heparin-binding activity. The growth factor is an extremely potent inducer of DNA synthesis in a variety of cell types from mesoderm and neuroectoderm lineages. It was originally named basic fibroblast growth factor based upon its chemical properties and to distinguish it from acidic fibroblast growth factor. Other homologous FGF belonging to the same family are int-2 (FGF-3), FGF-5, FGF-6, K-FGF and KGF ( keratinocyte growth factor = FGF-7). All factors are products of different genes, some of which are Oncogene products ( FGF-3, FGF-4, FGF-5 ).
Source :
E. Coli-derived P143-S288
Form :
Lyophilized
Contents :
Lyophilized after extensive dialysis against PBS.
AA Sequence and/or Biological Activity :
PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGR
VDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKE
DGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVA
LKRTGQYKLGSKTGPGQKAILFLPMSAKS
Amino Acid Sequence:
VDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKE
DGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVA
LKRTGQYKLGSKTGPGQKAILFLPMSAKS
Amino Acid Sequence:
Purification :
>95%, by SDS-PAGE quantitative densitometry by Coomassie® Blue Staining.
Storage :
Lyophilized recombinant mouse Fibroblast Growth Factor basic (FGF-basic/FGF-2) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rhFGF2 remains stable up to 2 weeks at 4°C or up to 3 months at -20°C.
Uniprot ID :
P09038
Molecular Weight :
16.5KD
company information
Boster
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
https://www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
questions and comments
