IL37 Interleukin-37 Human Recombinant Protein | Boster PROTQ9NZH6 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

protein

product name :

IL37 Interleukin-37 Human Recombinant Protein

catalog :

PROTQ9NZH6

quantity :

3 x2 ug, 25 ug, 1 mg

product information

SKU :

PROTQ9NZH6

Product Name :

IL37 Interleukin-37 Human Recombinant Protein

Product Page URL :

https://www.bosterbio.comil37-interleukin-37-human-recombinant-protein-protq9nzh6-boster.html

Gene Name :

IL37

Size :

3 x2 ug, 25 ug, 1 mg

Reactivity :

Mouse

Applications :

Cell Culture

Introduction :

Introduction: Human interleukin family 1, member 7 (IL1F7) belongs to the interleukin interleukin 18 (IL18), and afterward forms a complex with IL18 receptor beta subunit, and through which it inhibits the activity of IL18.

Description :

Interleukin-37 Human Recombinant produced in E.Coli is a single, non-glycosylated, Polypeptide chain containing 167 amino acids (Lys27-Asp192) and having a molecular mass of 18.6kDa. The IL37 is purified by proprietary chromatographic techniques.

Source :

E. Coli

Form :

Sterile Filtered White lyophilized (freeze-dried) powder.

Contents :

IL-37 was lyophilized after extensive dialysis against 20mM Phosphate buffer, pH7.4.

AA Sequence and/or Biological Activity :

Sequence:MKNLNPKKFSIHDQDHKVLVLDSGNLIAVP
DKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCL
YCDKDKGQSHPSLQLKKEKLMKLAAQKESARRPFIFYRA
QVGSWNMLESAAHPGWFICTSCNCNEPVGVTDKFENRKH
IEFSFQPVCKAEMSPSEVSD.
Amino Acid

Purification :

Greater than 95.0% as determined by:. (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Storage :

Lyophilized IL37 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL-37 should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.

Uniprot ID :

Q9NZH6

Gene Full Name :

Interleukin-37

Synonyms :

Interleukin-37;FIL1 zeta;IL-1X;Interleukin-1 family member 7;IL-1F7;Interleukin-1 homolog 4;IL-1H;IL-1H4;Interleukin-1 zeta;IL-1 zeta;Interleukin-1-related protein;IL-1RP1;Interleukin-23;IL-37;IL37;FIL1Z, IL1F7, IL1H4, IL1RP1;

Protein Function :

Suppressor of innate inflammatory and immune responses involved in curbing excessive inflammation. This function requires SMAD3. Suppresses, or reduces, proinflammatory cytokine production, including IL1A and IL6, as well as CCL12, CSF1, CSF2, CXCL13, IL1B, IL23A and IL1RN, but spares anti-inflammatory cytokines. Inhibits dendritic cell activation.

Subcellular Localization :

Cytoplasm, cytosol. Nucleus. Secreted. Stimulation with IL1B leads to colocalization with SMAD3 mostly in perinuclear regions. Only the CASP1-cleaved mature form translocates into the nucleus upon LPS stimulation.

Tissue Specificity :

In general, low constitutive expression, if any, in healthy tissues; high expression in inflammatory counterparts, including in synovial tissues from individuals with active rheumatoid arthritis. Isoform A, isoform B and isoform C are expressed in testis, colon, placenta, lung and lymph node. Isoform D and isoform E were found only in testis and bone marrow. Whereas only isoform A is found in brain, only isoform B in kidney and only isoform C in heart.