This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Boster
product type :
protein
product name :
PON1 Paraoxonase-1 Human Recombinant Protein
catalog :
PROTP27169
quantity :
2 ug, 10 ug, 1 mg
product information
SKU :
PROTP27169
Product Name :
PON1 Paraoxonase-1 Human Recombinant Protein
Product Page URL :
https://www.bosterbio.compon1-paraoxonase-1-human-recombinant-protein-protp27169-boster.html
Gene Name :
PON1
Size :
2 ug, 10 ug, 1 mg
Reactivity :
Mouse
Applications :
Cell Culture
Introduction :
Introduction: Paraoxonase 1 also called Esterase-A is involved in the detoxification of organophosphate insecticides such as parathion. Paraoxonase 1 may also confer protection against coronary artery disease by destroying proinflammatory oxidized lipids present in oxidized low-density lipoproteins (LDLs).
Description :
Paraoxonase-1 Isoform Human Recombinant is expressed in E. coli having a molecular weight of 42.9 kDa and fused to a 4.5kDa amino terminal hexahistidine tag. The PON1 purified by proprietary chromatographic techniques.
Source :
E. Coli
Form :
Sterile Filtered clear solution.
Contents :
PON1 is supplied in 20mM Tris-HCl pH 8.0 and 50% glycerol.
AA Sequence and/or Biological Activity :
Sequence:MAKLIALTLLGMGLALFRNHQSSYQTRLNA
LREVQPVELPNCNLVKGIETGSEDLEILPNGLAFISSGL
KYPGIKSFNPNSPGKILLMDLNEEDPTVLELGITGSKFD
VSSFNPHGISTFTDEDNAMYLLVVNHPDAKSTVELFKFQ
EEEKSLLHLKTIRHKLLPNLNDIVAVGPEHFYGTNDHYF
LDPYLRSWEMYLGLAWSYVVYYSPSEVRVVAEGFDFANG
INISPDGKYVYIAELLAHKIHVYEKHANWTLTPLKSLDF
NTLVDNISVDPETGDLWVGCHPNGMKIFFYDSENPPASE
VLRIQNILTEEPKVTQVYAENGTVLQGSTVASVYKGKLL
IGTVFHKALYCELZ.
Amino Acid
LREVQPVELPNCNLVKGIETGSEDLEILPNGLAFISSGL
KYPGIKSFNPNSPGKILLMDLNEEDPTVLELGITGSKFD
VSSFNPHGISTFTDEDNAMYLLVVNHPDAKSTVELFKFQ
EEEKSLLHLKTIRHKLLPNLNDIVAVGPEHFYGTNDHYF
LDPYLRSWEMYLGLAWSYVVYYSPSEVRVVAEGFDFANG
INISPDGKYVYIAELLAHKIHVYEKHANWTLTPLKSLDF
NTLVDNISVDPETGDLWVGCHPNGMKIFFYDSENPPASE
VLRIQNILTEEPKVTQVYAENGTVLQGSTVASVYKGKLL
IGTVFHKALYCELZ.
Amino Acid
Purification :
Greater than 95% as determined by SDS-PAGE. Single band on Western Blot.
Storage :
Store at 4°C if entire vial will be used within 1-2 weeks.
Store, frozen at -20°C for longer periods of time.
Avoid multiple freeze-thaw cycles.
Uniprot ID :
P27169
Gene Full Name :
Serum paraoxonase/arylesterase 1
Synonyms :
Serum paraoxonase/arylesterase 1;PON 1;3.1.1.2;3.1.1.81;3.1.8.1;Aromatic esterase 1;A-esterase 1;K-45;Serum aryldialkylphosphatase 1;PON1;PON;
Protein Function :
Hydrolyzes the toxic metabolites of a variety of organophosphorus insecticides. Capable of hydrolyzing a broad spectrum of organophosphate substrates and lactones, and a number of aromatic carboxylic acid esters. Mediates an enzymatic protection of low density lipoproteins against oxidative modification and the consequent series of events leading to atheroma formation.
Subcellular Localization :
Secreted, extracellular space.
Tissue Specificity :
Plasma, associated with HDL (at protein level). Expressed in liver, but not in heart, brain, placenta, lung, skeletal muscle, kidney or pancreas.
company information
Boster
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
https://www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
questions and comments
