GNLY Granulysin Human Recombinant Protein | Boster PROTP22749 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

protein

product name :

GNLY Granulysin Human Recombinant Protein

catalog :

PROTP22749

quantity :

2 ug, 10 ug, 1 mg

product information

SKU :

PROTP22749

Product Name :

GNLY Granulysin Human Recombinant Protein

Product Page URL :

https://www.bosterbio.comgnly-granulysin-human-recombinant-protein-protp22749-boster.html

Gene Name :

GNLY

Size :

2 ug, 10 ug, 1 mg

Reactivity :

Mouse

Applications :

Cell Culture

Introduction :

Introduction: GNLY is part of the SAPLIP family and is located in the cytotoxic granules of T cells, which are discharged upon antigen stimulation. GNLY is localized in cytotoxic granules of cytotoxic T lymphocytes and natural killer cells, and it has antimicrobial activity against M. tuberculosis and other organisms. GNLY is an antimicrobial protein that kills intracellular pathogens. GNLY is active against a wide range of microbes, including Gram-positive and Gram-negative bacteria, fungi, and parasites. Kills Mycobacterium tuberculosis.

Description :

GNLY Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 159 amino acids and fused to a double His Tag (N+C terminus) and having a total molecular mass of 18.1 kDa. The GNLY is purified by proprietary chromatographic techniques.

Source :

E. Coli

Form :

Sterile Filtered White lyophilized (freeze-dried) powder.

Contents :

The Granulysin protein was lyophilized from a concentrated (1mg/ml) solution containing no additives.

AA Sequence and/or Biological Activity :

Sequence:MGSSHHHHHHSSGLVPRGSHMMEGLVFSRL
SPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQELG
RDYRTCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSR
WRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIPS
TGPLGSHHHHHH.
Amino Acid

Purification :

Greater than 95.0% as determined by SDS-PAGE.

Storage :

Lyophilized Granulysin although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Granulysin should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.

Uniprot ID :

P22749

Gene Full Name :

Granulysin

Synonyms :

Granulysin;Lymphokine LAG-2;Protein NKG5;T-cell activation protein 519;GNLY;LAG2, NKG5, TLA519;

Protein Function :

Antimicrobial protein that kills intracellular pathogens. Active against a broad range of microbes, including Gram-positive and Gram-negative bacteria, fungi, and parasites. Kills Mycobacterium tuberculosis.

Subcellular Localization :

Secreted. Located in the cytotoxic granules of T-cells, which are released upon antigen stimulation.

Tissue Specificity :

Expressed in natural killer and T-cells.