BMP-2 Bone Morphogenetic protein-2 Human Recombinant Protein, HEK

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

protein

product name :

BMP-2 Bone Morphogenetic protein-2 Human Recombinant Protein, HEK

catalog :

PROTP12643

quantity :

2 ug, 10 ug, 100 ug

product information

SKU :

PROTP12643

Product Name :

BMP-2 Bone Morphogenetic protein-2 Human Recombinant Protein, HEK

Product Page URL :

https://www.bosterbio.combmp-2-bone-morphogenetic-protein-2-human-recombinant-protein-hek-protp12643-boster.html

Gene Name :

BMP2

Size :

2 ug, 10 ug, 100 ug

Reactivity :

Mouse

Applications :

Cell Culture

Introduction :

Introduction: BMP2 belongs to the transforming growth factor-beta (TGFB) superfamily. Bone morphogenic protein induces bone formation. BMP2 is a candidate gene for the autosomal dominant disease of fibrodysplasia (myositis) ossificans progressiva.

Description :

BMP-2 Human Recombinant produced in HEK cells is a glycosylated disulfide-linked homodimer, having a molecular weight range of 28kDa due to glycosylation. The BMP2 is purified by proprietary chromatographic techniques.

Source :

HEK.

Form :

Sterile Filtered White lyophilized (freeze-dried) powder.

Contents :

The BMP2 was lyophilized from 0.66mg/ml in 2xPBS + 6% ethanol.

AA Sequence and/or Biological Activity :

NHAIVQTLVNSVNSKIPKACCVPTELSAISMLYLDENEKVVLKNYQDMVVEGCGCR.
Sequence:QAKHKQRKRLKSSCKRHPLYVDFSDVGWND
WIVAPPGYHAFYCHGECPFPLADHLNST
Amino Acid

Purification :

Greater than 95% as obsereved by SDS-PAGE.

Storage :

Lyophilized BMP2 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution BMP-2 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.

Uniprot ID :

P12643

Gene Full Name :

Bone morphogenetic protein 2

Synonyms :

Bone morphogenetic protein 2;BMP-2;Bone morphogenetic protein 2A;BMP-2A;BMP2;BMP2A;

Protein Function :

Induces cartilage and bone formation (PubMed:3201241). Stimulates the differentiation of myoblasts into osteoblasts via the EIF2AK3-EIF2A- ATF4 pathway. BMP2 activation of EIF2AK3 stimulates phosphorylation of EIF2A which leads to increased expression of ATF4 which plays a central role in osteoblast differentiation. In addition stimulates TMEM119, which upregulates the expression of ATF4 (PubMed:24362451).

Subcellular Localization :

Secreted.

Tissue Specificity :

Particularly abundant in lung, spleen and colon and in low but significant levels in heart, brain, placenta, liver, skeletal muscle, kidney, pancreas, prostate, ovary and small intestine.