GH Growth Hormone Rainbow Trout (Oncorhynchus mykiss) Recombinant Protein

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

protein

product name :

GH Growth Hormone Rainbow Trout (Oncorhynchus mykiss) Recombinant Protein

catalog :

PROTP09538

quantity :

2 ug, 10 ug, 1 mg

product information

SKU :

PROTP09538

Product Name :

GH Growth Hormone Rainbow Trout (Oncorhynchus mykiss) Recombinant Protein

Product Page URL :

https://www.bosterbio.comgh-growth-hormone-rainbow-trout-oncorhynchus-mykiss-recombinant-protein-protp09538-boster.html

Gene Name :

gh1

Size :

2 ug, 10 ug, 1 mg

Reactivity :

Mouse

Applications :

Cell Culture

Introduction :

Introduction: GH is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. The gene, along with four other related genes, is located at the growth hormone locus on chromosome 17 where they are interspersed in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. The five genes share a remarkably high degree of sequence identity. Alternative splicing generates additional isoforms of each of the five growth hormones, leading to further diversity and potential for specialization. This particular family member is expressed in the pituitary but not in placental tissue as is the case for the other four genes in the growth hormone locus. Mutations in or deletions of the gene lead to growth hormone deficiency and short stature.

Description :

Somatotropin Rainbow Trout (Oncorhynchus mykiss) Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 188 amino acids with an additional Ala at the N-terminus and having a molecular mass of 21, 535 Dalton. The Rainbow Trout (Oncorhynchus mykiss) Growth-Hormone Recombinant is purified by proprietary chromatographic techniques.

Source :

E. Coli

Form :

Sterile Filtered White lyophilized (freeze-dried) powder.

Contents :

The protein was lyophilized from a concentrated (1mg/ml) solution with 0.5% NaHCO3. Adjusted to pH-8.

AA Sequence and/or Biological Activity :

Biological Activity: Somatotropin Rainbow Trout (Oncorhynchus mykiss) Recombinant is biologically active in PDF-P1 3B9 cells stable transfected with rabbit GH receptors, though its activity is about 10 fold lower than that of human GH.
AIENQRLFNIAVSRVQHLHLLAQKMFNDFDGTLLPDERR
QLNKIFLLDFCNSDSIVSPVDKHETQKSSVLKLLHISFR
LIESWEYPSQTLIISNSLMVRNANQISEKLSDLKVGINL
LITGSQDGVLSLDDNDSQQLPPYGNYYQNLGGDGNVRRN
YELLACFKKDMHKVETYLTVAKCRKSLEANCTL.
Amino Acid Sequence:

Purification :

Greater than 95.0% as determined by: (a) Analysis by SEC-HPLC. (b) Analysis by SDS-PAGE.

Storage :

Lyophilized Growth-Hormone Rainbow Trout (Oncorhynchus mykiss) although stable at room temperature for at least two weeks, should be stored desiccated below -18°C. Upon reconstitution and filter sterilization GH can be stored at 4°C, pH 9 for up to 4 weeks. For long term storage and more diluted solutions it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.

Uniprot ID :

P09538

Gene Full Name :

Somatotropin-1

Synonyms :

Somatotropin-1;Growth hormone 1;gh1;

Protein Function :

Growth hormone plays an important role in growth control and is involved in the regulation of several anabolic processes. Implicated as an osmoregulatory substance important for seawater adaptation.

Subcellular Localization :

Secreted.