IP-10 Human Recombinant Protein (CXCL10) | Boster PROTP02778 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

protein

product name :

IP-10 Human Recombinant Protein (CXCL10)

catalog :

PROTP02778

quantity :

5 ug, 25 ug, 1 mg

product information

SKU :

PROTP02778

Product Name :

IP-10 Human Recombinant Protein (CXCL10)

Product Page URL :

https://www.bosterbio.comip-10-human-recombinant-protein-cxcl10-protp02778-boster.html

Gene Name :

CXCL10

Size :

5 ug, 25 ug, 1 mg

Reactivity :

Mouse

Applications :

Cell Culture

Introduction :

Introduction: Chemokine (C-X-C motif) ligand 10 (CXCL10) is a small cytokine belonging to the CXC chemokine family that is also known as 10 kDa interferon-gamma-induced protein (?-IP10 or IP-10). CXCL10 is secreted by several cell types in response to IFN-?. These cell types include monocytes, endothelial cells and fibroblasts. CXCL10 has been attributed to several roles, such as chemoattraction for monocytes and T cells, promotion of T cell adhesion to endothelial cells, antitumor activity, and inhibition of bone marrow colony formation and angiogenesis. The gene for CXCL10 is located on human chromosome 4 in a cluster among several other CXC chemokines. This chemokine elicits its effects by binding to the cell surface chemokine receptor CXCR3. The three-dimensional crystal structure of this chemokine has been determined under 3 different conditions to a resolution of up to 1.92A.

Description :

IP-10 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 77 amino acids and having a molecular mass of 8.6kDa. The IP-10 is purified by proprietary chromatographic techniques.

Source :

E. Coli

Form :

Sterile Filtered White lyophilized (freeze-dried) powder.

Contents :

Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA).

AA Sequence and/or Biological Activity :

IKNLLKAVSKEMSKRSP.
Sequence:VPLSRTVRCTCISISNQPVNPRSLEKLEII
PASQFCPRVEIIATMKKKGEKRCLNPESKA
Amino Acid

Purification :

Greater than 95.0% as determined by SDS-PAGE.

Storage :

Lyophilized IP-10 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CXCL10 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.

Uniprot ID :

P02778

Gene Full Name :

C-X-C motif chemokine 10

Synonyms :

C-X-C motif chemokine 10;10 kDa interferon gamma-induced protein;Gamma-IP10;IP-10;Small-inducible cytokine B10;CXCL10 (1-73);CXCL10;INP10, SCYB10;

Protein Function :

Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3.

Subcellular Localization :

Secreted.