This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Boster
product type :
protein
product name :
IP-10 Human Recombinant Protein (CXCL10)
catalog :
PROTP02778
quantity :
5 ug, 25 ug, 1 mg
product information
SKU :
PROTP02778
Product Name :
IP-10 Human Recombinant Protein (CXCL10)
Product Page URL :
https://www.bosterbio.comip-10-human-recombinant-protein-cxcl10-protp02778-boster.html
Gene Name :
CXCL10
Size :
5 ug, 25 ug, 1 mg
Reactivity :
Mouse
Applications :
Cell Culture
Introduction :
Introduction: Chemokine (C-X-C motif) ligand 10 (CXCL10) is a small cytokine belonging to the CXC chemokine family that is also known as 10 kDa interferon-gamma-induced protein (?-IP10 or IP-10). CXCL10 is secreted by several cell types in response to IFN-?. These cell types include monocytes, endothelial cells and fibroblasts. CXCL10 has been attributed to several roles, such as chemoattraction for monocytes and T cells, promotion of T cell adhesion to endothelial cells, antitumor activity, and inhibition of bone marrow colony formation and angiogenesis. The gene for CXCL10 is located on human chromosome 4 in a cluster among several other CXC chemokines. This chemokine elicits its effects by binding to the cell surface chemokine receptor CXCR3. The three-dimensional crystal structure of this chemokine has been determined under 3 different conditions to a resolution of up to 1.92A.
Description :
IP-10 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 77 amino acids and having a molecular mass of 8.6kDa. The IP-10 is purified by proprietary chromatographic techniques.
Source :
E. Coli
Form :
Sterile Filtered White lyophilized (freeze-dried) powder.
Contents :
Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA).
AA Sequence and/or Biological Activity :
IKNLLKAVSKEMSKRSP.
Sequence:VPLSRTVRCTCISISNQPVNPRSLEKLEII
PASQFCPRVEIIATMKKKGEKRCLNPESKA
Amino Acid
Sequence:VPLSRTVRCTCISISNQPVNPRSLEKLEII
PASQFCPRVEIIATMKKKGEKRCLNPESKA
Amino Acid
Purification :
Greater than 95.0% as determined by SDS-PAGE.
Storage :
Lyophilized IP-10 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CXCL10 should be stored at 4°C between 2-7 days and for future use below -18°C.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.
Uniprot ID :
P02778
Gene Full Name :
C-X-C motif chemokine 10
Synonyms :
C-X-C motif chemokine 10;10 kDa interferon gamma-induced protein;Gamma-IP10;IP-10;Small-inducible cytokine B10;CXCL10 (1-73);CXCL10;INP10, SCYB10;
Protein Function :
Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3.
Subcellular Localization :
Secreted.
company information
Boster
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
https://www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
questions and comments
