This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Boster
product type :
antibody
product name :
Anti-Ago2/eIF2C2 Antibody Picoband™
catalog :
PB9978
quantity :
100μg/vial
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot
product information
SKU :
PB9978
Product Name :
Anti-Ago2/eIF2C2 Antibody Picoband™
Size :
100μg/vial
Clonality :
Polyclonal
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Predicted Reactivity :
Bovine, Canine, Hamster, Horse, Monkey, Rabbit
Application(s) :
WB
Application Details :
Western blot, 0.1-0.5µg/ml, Human, Mouse, Rat.
Application Notes :
Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
Description :
Boster Bio Anti-Ago2/eIF2C2 Antibody Picoband™ catalog # PB9978. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.
Concentration :
Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Gene Name :
AGO2
Uniprot ID :
Q9UKV8
Immunogen :
identical to the related mouse and rat sequences.
KVSIKWVSCVSLQALHDALSGRLPSVPFETIQALDVVMR
HL),
A synthetic peptide corresponding to a sequence at the N-terminus of human Ago2/ eIF2C2 (129-169aa
Form :
Lyophilized
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Cross-reactivity :
No cross reactivity with other proteins.
Storage :
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Gene Full Name :
Protein argonaute-2
Synonyms :
Protein argonaute-2 ; Argonaute2 ; hAgo2; 3.1.26.n2 ; Argonaute RISC catalytic component 2; Eukaryotic translation initiation factor 2C 2 ; eIF-2C 2 ; eIF2C 2 ; PAZ Piwi domain protein; PPD; Protein slicer ; AGO2; EIF2C2;
Protein Name :
Protein argonaute-2
Molecular Weight :
97208 MW
Protein Function :
Required for RNA-mediated gene silencing (RNAi) by the RNA-induced silencing complex (RISC). The 'minimal RISC' appears to include AGO2 bound to a short guide RNA such as a microRNA (miRNA) or short interfering RNA (siRNA). These guide RNAs direct RISC to complementary mRNAs that are targets for RISC-mediated gene silencing. The precise mechanism of gene silencing depends on the degree of complementarity between the miRNA or siRNA and its target. Binding of RISC to a perfectly complementary mRNA generally results in silencing due to endonucleolytic cleavage of the mRNA specifically by AGO2. Binding of RISC to a partially complementary mRNA results in silencing through inhibition of translation, and this is independent of endonuclease activity. May inhibit translation initiation by binding to the 7-methylguanosine cap, thereby preventing the recruitment of the translation initiation factor eIF4-E. May also inhibit translation initiation via interaction with EIF6, which itself binds to the 60S ribosomal subunit and prevents its association with the 40S ribosomal subunit. The inhibition of translational initiation leads to the accumulation of the affected mRNA in cytoplasmic processing bodies (P-bodies), where mRNA degradation may subsequently occur. In some cases RISC-mediated translational repression is also observed for miRNAs that perfectly match the 3' untranslated region (3'-UTR). Can also up-regulate the translation of specific mRNAs under certain growth conditions. Binds to the AU element of the 3'-UTR of the TNF (TNF-alpha) mRNA and up-regulates translation under conditions of serum starvation. Also required for transcriptional gene silencing (TGS), in which short RNAs known as antigene RNAs or agRNAs direct the transcriptional repression of complementary promoter regions.
Subcellular Localization :
Cytoplasm, P-body. Nucleus. Translational repression of mRNAs results in their recruitment to P-bodies. Translocation to the nucleus requires IMP8.
Recommended Detection Systems :
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot.
Background :
Protein argonaute-2, also known as AGO2, is a protein that in humans is encoded by the EIF2C2 gene. This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, and contains a PAZ domain and a PIWI domain. It may interact with dicer1 and play a role in short-interfering-RNA-mediated gene silencing. Multiple transcript variants encoding different isoforms have been found for this gene.
Research Category :
ChIP’ing Antibodies, DNA / RNA, Epigenetics and Nuclear Signaling, Nuclear Receptors, Nuclear Signaling Pathways, RNA Processing
company information
Boster
3942 B Valley Ave
Pleasanton, CA 94566
boster@bosterbio.com
https://www.bosterbio.com
925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits