Anti-GAL4/LGALS4 Antibody Picoband™ | Boster PB9952 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-GAL4/LGALS4 Antibody Picoband™

catalog :

PB9952

quantity :

100μg/vial

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human

application :

western blot, immunocytochemistry, flow cytometry

product information

SKU :

PB9952

Product Name :

Anti-GAL4/LGALS4 Antibody Picoband™

Size :

100μg/vial

Clonality :

Polyclonal

Host :

Rabbit

Reactivity :

Human

Application(s) :

Flow Cytometry, IF, ICC, WB

Application Details :

Western blot, 0.1-0.5µg/ml, Human. Immunocytochemistry/Immunofluorescence, 2µg/ml, Human. Flow Cytometry, 1-3µg/1x10^6 cells, Human.

Application Notes :

Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Description :

Boster Bio Anti-GAL4/LGALS4 Antibody Picoband™ catalog # PB9952. Tested in Flow Cytometry, IF, ICC, WB applications. This antibody reacts with Human.

Concentration :

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

Gene Name :

LGALS4

Uniprot ID :

P56470

Immunogen :

A synthetic peptide corresponding to a sequence at the C-terminus of human GAL4 (283-320aa DRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSY), different from the related mouse and rat sequences by seven amino acids.

Form :

Lyophilized

Contents :

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na 2 HPO 4 , 0.05mg NaN 3 .

Purification :

Immunogen affinity purified.

Cross-reactivity :

No cross reactivity with other proteins

Storage :

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Gene Full Name :

Galectin-4

Synonyms :

Galectin-4; Gal-4; Antigen NY-CO-27; L-36 lactose-binding protein; L36LBP; Lactose-binding lectin 4; LGALS4;

Protein Name :

Galectin-4

Molecular Weight :

35941 MW

Protein Function :

Galectin that binds lactose and a related range of sugars. May be involved in the assembly of adherens junctions.

Recommended Detection Systems :

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot.

Background :

Galectin-4 is a protein that in humans is encoded by the LGALS4 gene. This gene is mapped to chromosome 19q13.2 based on an alignment of the LGALS4 sequence. The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS4 is an S-type lectin that is strongly underexpressed in colorectal cancer. The 323-amino acid LGALS4 protein contains 2 homologous, approximately 150-amino acid carbohydrate recognition domains and all amino acids typically conserved in galectins.

Research Category :

Cancer, Cell Adhesion, ChIP’ing Antibodies, Cytoskeleton / Ecm, Energy Metabolism, Energy Transfer Pathways, Epigenetics and Nuclear Signaling, Metabolic Signaling Pathways, Metabolism, Pathways And Processes, Signal Transduction, Tags & Cell Markers, Transcription, Transcription Factors