Anti-IL7R alpha Antibody Picoband™ | Boster PB9948 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-IL7R alpha Antibody Picoband™

catalog :

PB9948

quantity :

100μg/vial

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, rat

application :

western blot, flow cytometry

product information

SKU :

PB9948

Product Name :

Anti-IL7R alpha Antibody Picoband™

Size :

100μg/vial

Clonality :

Polyclonal

Host :

Rabbit

Reactivity :

Human, Rat

Application(s) :

Flow Cytometry, WB

Application Details :

Western blot, 0.1-0.5µg/ml, Human, Rat. Flow Cytometry, 1-3µg/1x10^6 cells, Human.

Application Notes :

Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Description :

Boster Bio Anti-IL7R alpha Antibody Picoband™ catalog # PB9948. Tested in Flow Cytometry, WB applications. This antibody reacts with Human, Rat.

Concentration :

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

Gene Name :

IL7R

Uniprot ID :

P16871

Immunogen :

A synthetic peptide corresponding to a sequence at the C-terminus of human IL7R alpha (278-315aa DHKKTLEHLCKKPRKNLNVSFNPESFLDCQIHRVDDIQ), different from the related mouse sequence by nine amino acids.

Form :

Lyophilized

Contents :

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purification :

Immunogen affinity purified.

Cross-reactivity :

No cross reactivity with other proteins

Storage :

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Gene Full Name :

Interleukin-7 receptor subunit alpha

Synonyms :

Interleukin-7 receptor subunit alpha; IL-7 receptor subunit alpha; IL-7R subunit alpha; IL-7R-alpha; IL-7RA; CDw127; CD127; IL7R;

Protein Name :

Interleukin-7 receptor subunit alpha

Molecular Weight :

51581 MW

Protein Function :

Receptor for interleukin-7. Also acts as a receptor for thymic stromal lymphopoietin (TSLP).

Subcellular Localization :

Isoform 1: Cell membrane; Single-pass type I membrane protein.

Recommended Detection Systems :

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot.

Background :

The interleukin-7 receptor, also known as IL7R alpha, is a protein found on the surface of cells. It is mapped to 5p13. Interleukin-7 receptor has been shown to play a critical role in the development of immune cells called lymphocytes - specifically in a process known as V (D)J recombination. This protein is also found to control the accessibility of a region of the genome that contains the T-cell receptor gamma gene, by STAT5 and histone acetylation. Knockout studies in mice suggest that blocking apoptosis is an essential function of this protein during differentiation and activation of T lymphocytes. Functional defects in this protein may be associated with the pathogenesis of severe combined immunodeficiency (SCID).

Research Category :

Cytokines, Hematopoietic Progenitors, Immunology, Innate Immunity, Interleukins, Lymphoid, Myeloid, Stem Cells, T Lymphocytic Lineage