This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Boster
product type :
antibody
product name :
Anti-IL7R alpha Antibody Picoband™
catalog :
PB9948
quantity :
100μg/vial
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, rat
application :
western blot, flow cytometry
product information
SKU :
PB9948
Product Name :
Anti-IL7R alpha Antibody Picoband™
Size :
100μg/vial
Clonality :
Polyclonal
Host :
Rabbit
Reactivity :
Human, Rat
Application(s) :
Flow Cytometry, WB
Application Details :
Western blot, 0.1-0.5µg/ml, Human, Rat. Flow Cytometry, 1-3µg/1x10^6 cells, Human.
Application Notes :
Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
Description :
Boster Bio Anti-IL7R alpha Antibody Picoband™ catalog # PB9948. Tested in Flow Cytometry, WB applications. This antibody reacts with Human, Rat.
Concentration :
Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Gene Name :
IL7R
Uniprot ID :
P16871
Immunogen :
A synthetic peptide corresponding to a sequence at the C-terminus of human IL7R alpha (278-315aa DHKKTLEHLCKKPRKNLNVSFNPESFLDCQIHRVDDIQ), different from the related mouse sequence by nine amino acids.
Form :
Lyophilized
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Cross-reactivity :
No cross reactivity with other proteins
Storage :
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Gene Full Name :
Interleukin-7 receptor subunit alpha
Synonyms :
Interleukin-7 receptor subunit alpha; IL-7 receptor subunit alpha; IL-7R subunit alpha; IL-7R-alpha; IL-7RA; CDw127; CD127; IL7R;
Protein Name :
Interleukin-7 receptor subunit alpha
Molecular Weight :
51581 MW
Protein Function :
Receptor for interleukin-7. Also acts as a receptor for thymic stromal lymphopoietin (TSLP).
Subcellular Localization :
Isoform 1: Cell membrane; Single-pass type I membrane protein.
Recommended Detection Systems :
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot.
Background :
The interleukin-7 receptor, also known as IL7R alpha, is a protein found on the surface of cells. It is mapped to 5p13. Interleukin-7 receptor has been shown to play a critical role in the development of immune cells called lymphocytes - specifically in a process known as V (D)J recombination. This protein is also found to control the accessibility of a region of the genome that contains the T-cell receptor gamma gene, by STAT5 and histone acetylation. Knockout studies in mice suggest that blocking apoptosis is an essential function of this protein during differentiation and activation of T lymphocytes. Functional defects in this protein may be associated with the pathogenesis of severe combined immunodeficiency (SCID).
Research Category :
Cytokines, Hematopoietic Progenitors, Immunology, Innate Immunity, Interleukins, Lymphoid, Myeloid, Stem Cells, T Lymphocytic Lineage
company information
Boster
3942 B Valley Ave
Pleasanton, CA 94566
boster@bosterbio.com
https://www.bosterbio.com
925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits