Anti-VRK1 Antibody Picoband™ | Boster PB9907 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-VRK1 Antibody Picoband™

catalog :

PB9907

quantity :

100μg/vial

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, rat

application :

western blot

product information

SKU :

PB9907

Product Name :

Anti-VRK1 Antibody Picoband™

Size :

100μg/vial

Clonality :

Polyclonal

Host :

Rabbit

Reactivity :

Human, Rat

Application(s) :

Application Details :

Western blot, 0.1-0.5µg/ml, Human, Rat.

Application Notes :

Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Description :

Boster Bio Anti-VRK1 Antibody Picoband™ catalog # PB9907. Tested in WB applications. This antibody reacts with Human, Rat.

Concentration :

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

Gene Name :

VRK1

Uniprot ID :

Q99986

Immunogen :

A synthetic peptide corresponding to a sequence at the C-terminus of human VRK1 (292-329aa EKNKPGEIAKYMETVKLLDYTEKPLYENLRDILLQGLK), different from the related mouse sequence by three amino acids.

Form :

Lyophilized

Contents :

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purification :

Immunogen affinity purified.

Cross-reactivity :

No cross reactivity with other proteins.

Storage :

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Gene Full Name :

Serine/threonine-protein kinase VRK1

Synonyms :

Serine/threonine-protein kinase VRK1; 2.7.11.1; Vaccinia-related kinase 1; VRK1;

Protein Name :

Serine/threonine-protein kinase VRK1

Molecular Weight :

45476 MW

Protein Function :

Serine/threonine kinase involved in Golgi disassembly during the cell cycle: following phosphorylation by PLK3 during mitosis, required to induce Golgi fragmentation. Acts by mediating phosphorylation of downstream target protein. Phosphorylates 'Thr- 18' of p53/TP53 and may thereby prevent the interaction between p53/TP53 and MDM2. Phosphorylates casein and histone H3. Phosphorylates BANF1: disrupts its ability to bind DNA, reduces its binding to LEM domain-containing proteins and causes its relocalization from the nucleus to the cytoplasm. Phosphorylates ATF2 which activates its transcriptional activity.

Subcellular Localization :

Cytoplasm. Nucleus. Cytoplasm, cytoskeleton, spindle. Dispersed throughout the cell but not located on mitotic spindle or chromatids during mitosis.

Tissue Specificity :

Widely expressed. Highly expressed in fetal liver, testis and thymus.

Recommended Detection Systems :

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot.

Background :

Serine/threonine-protein kinase VRK1 is an enzyme that in humans is encoded by the VRK1 gene. This gene encodes a member of the vaccinia-related kinase (VRK) family of serine/threonine protein kinases. It is widely expressed in human tissues and has increased expression in actively dividing cells, such as those in testis, thymus, fetal liver, and carcinomas. Its protein localizes to the nucleus and has been shown to promote the stability and nuclear accumulation of a transcriptionally active p53 molecule and, in vitro, to phosphorylate Thr18 of p53 and reduce p53 ubiquitination. This gene, therefore, may regulate cell proliferation. This protein also phosphorylates histone, casein, and the transcription factors ATF2 (activating transcription factor 2) and c-JUN.

Research Category :

Cell Biology, Cell Cycle, Cell Cycle Inhibitors, Epigenetics and Nuclear Signaling, Protein Phosphorylation, Ser / Thr Kinases, Signal Transduction