Anti-Staufen/STAU1 Antibody Picoband™ | Boster PB9895 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-Staufen/STAU1 Antibody Picoband™

catalog :

PB9895

quantity :

100μg/vial

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human

application :

western blot

product information

SKU :

PB9895

Product Name :

Anti-Staufen/STAU1 Antibody Picoband™

Size :

100μg/vial

Clonality :

Polyclonal

Host :

Rabbit

Reactivity :

Human

Predicted Reactivity :

Chicken

Application(s) :

Application Details :

Western blot, 0.1-0.5µg/ml, Human.

Application Notes :

Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Description :

Boster Bio Anti-Staufen/STAU1 Antibody Picoband™ catalog # PB9895. Tested in WB applications. This antibody reacts with Human.

Concentration :

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

Gene Name :

STAU1

Uniprot ID :

O95793

Immunogen :

A synthetic peptide corresponding to a sequence at the C-terminus of human Staufen (532-568aa HGIGKDVESCHDMAALNILKLLSELDQQSTEMPRTGN), identical to the related mouse sequence.

Form :

Lyophilized

Contents :

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purification :

Immunogen affinity purified.

Cross-reactivity :

No cross reactivity with other proteins.

Storage :

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Gene Full Name :

Double-stranded RNA-binding protein Staufen homolog 1

Synonyms :

Double-stranded RNA-binding protein Staufen homolog 1; STAU1; STAU;

Protein Name :

Double-stranded RNA-binding protein Staufen homolog 1

Molecular Weight :

63182 MW

Protein Function :

Binds double-stranded RNA (regardless of the sequence) and tubulin. May play a role in specific positioning of mRNAs at given sites in the cell by cross-linking cytoskeletal and RNA components, and in stimulating their translation at the site.

Subcellular Localization :

Cytoplasm. Rough endoplasmic reticulum. Localizes exclusively with the rough reticulum endoplasmic (RER).

Tissue Specificity :

Widely expressed. Expressed in brain, pancreas, heart, skeletal muscles, liver, lung, kidney and placenta.

Recommended Detection Systems :

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot.

Background :

Double-stranded RNA-binding protein Staufen homolog 1 is a protein that in humans is encoded by the STAU1 gene. Staufen is a member of the family of double-stranded RNA (dsRNA)-binding proteins involved in the transport and/or localization of mRNAs to different subcellular compartments and/or organelles. These proteins are characterized by the presence of multiple dsRNA-binding domains which are required to bind RNAs having double-stranded secondary structures. The human homologue of staufen encoded by STAU, in addition contains a microtubule- binding domain similar to that of microtubule-associated protein 1B, and binds tubulin. The STAU gene product has been shown to be present in the cytoplasm in association with the rough endoplasmic reticulum (RER), implicating this protein in the transport of mRNA via the microtubule network to the RER, the site of translation. Five transcript variants resulting from alternative splicing of STAU gene and encoding three isoforms have been described. Three of these variants encode the same isoform, however, differ in their 5'UTR.

Research Category :

Cytoskeleton, Cytoskeleton / Ecm, Microtubules, Neurogenesis, Neurology Process, Neuroscience, Signal Transduction, Tubulin