Anti-MDMX/MDM4 Antibody Picoband™ | Boster PB9872 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-MDMX/MDM4 Antibody Picoband™

catalog :

PB9872

quantity :

100μg/vial

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse

application :

western blot, immunohistochemistry

product information

SKU :

PB9872

Product Name :

Anti-MDMX/MDM4 Antibody Picoband™

Size :

100μg/vial

Clonality :

Polyclonal

Host :

Rabbit

Reactivity :

Human, Mouse

Predicted Reactivity :

Bovine, Horse, Monkey, Rabbit

Application(s) :

IHC, WB

Application Details :

Immunohistochemistry (Paraffin-embedded Section), 0.5-1µg/ml, Human, By Heat. Western blot, 0.1-0.5µg/ml, Human, Mouse.

Application Notes :

Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

Description :

Boster Bio Anti-MDMX/MDM4 Antibody Picoband™ catalog # PB9872. Tested in IHC, WB applications. This antibody reacts with Human, Mouse.

Concentration :

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

Gene Name :

MDM4

Uniprot ID :

O15151

Immunogen :

A synthetic peptide corresponding to a sequence at the N-terminus of human MDMX (35-72aa KILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQH), different from the related mouse sequence by two amino acids, and from the related rat sequence by three amino acids.

Form :

Lyophilized

Contents :

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purification :

Immunogen affinity purified.

Cross-reactivity :

No cross reactivity with other proteins.

Storage :

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Gene Full Name :

Protein Mdm4

Synonyms :

Protein Mdm4; Double minute 4 protein; Mdm2-like p53-binding protein; Protein Mdmx; p53-binding protein Mdm4; MDM4; MDMX;

Protein Name :

Protein Mdm4

Molecular Weight :

54864 MW

Protein Function :

Inhibits p53/TP53- and TP73/p73-mediated cell cycle arrest and apoptosis by binding its transcriptional activation domain. Inhibits degradation of MDM2. Can reverse MDM2-targeted degradation of TP53 while maintaining suppression of TP53 transactivation and apoptotic functions.

Subcellular Localization :

Nucleus.

Tissue Specificity :

Expressed in all tissues tested with high levels in thymus.

Recommended Detection Systems :

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).

Background :

Protein Mdm4 is a protein that in humans is encoded by the MDM4 gene. This gene encodes a nuclear protein that contains a p53 binding domain at the N-terminus and a RING finger domain at the C-terminus, and shows structural similarity to p53-binding protein MDM2. Both proteins bind the p53 tumor suppressor protein and inhibit its activity, and have been shown to be overexpressed in a variety of human cancers. However, unlike MDM2 which degrades p53, this protein inhibits p53 by binding its transcriptional activation domain. This protein also interacts with MDM2 protein via the RING finger domain, and inhibits the latter's degradation. So this protein can reverse MDM2-targeted degradation of p53, while maintaining suppression of p53 transactivation and apoptotic functions. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.

Research Category :

Apoptosis, Cancer, Cell Biology, Cell Cycle, Cell Death, Epigenetics and Nuclear Signaling, Metabolism, Metabolism Processes, Nuclear, Nucleus, Pathways And Processes