Anti-UNC5C Antibody Picoband™ | Boster PB9841 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-UNC5C Antibody Picoband™

catalog :

PB9841

quantity :

100μg/vial

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot

product information

SKU :

PB9841

Product Name :

Anti-UNC5C Antibody Picoband™

Size :

100μg/vial

Clonality :

Polyclonal

Host :

Rabbit

Reactivity :

Human, Mouse, Rat

Predicted Reactivity :

Chicken

Application(s) :

Application Details :

Western blot, 0.1-0.5µg/ml, Human, Mouse, Rat.

Application Notes :

Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Description :

Boster Bio Anti-UNC5C Antibody Picoband™ catalog # PB9841. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.

Concentration :

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

Gene Name :

UNC5C

Uniprot ID :

O95185

Immunogen :

A synthetic peptide corresponding to a sequence at the C-terminus of human UNC5C (894-930aa DLWEAQNFPDGNLSMLAAVLEEMGRHETVVSLAAEGQ), identical to the related mouse and rat sequences.

Form :

Lyophilized

Contents :

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purification :

Immunogen affinity purified.

Cross-reactivity :

No cross reactivity with other proteins

Storage :

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Gene Full Name :

Netrin receptor UNC5C

Synonyms :

Netrin receptor UNC5C; Protein unc-5 homolog 3; Protein unc-5 homolog C; UNC5C; UNC5H3;

Protein Name :

Netrin receptor UNC5C

Molecular Weight :

103146 MW

Protein Function :

Receptor for netrin required for axon guidance. Mediates axon repulsion of neuronal growth cones in the developing nervous system upon ligand binding. Axon repulsion in growth cones may be caused by its association with DCC that may trigger signaling for repulsion. Also involved in corticospinal tract axon guidances independently of DCC. It also acts as a dependence receptor required for apoptosis induction when not associated with netrin ligand.

Subcellular Localization :

Cell membrane ; Single-pass type I membrane protein. Cell junction, synapse, synaptosome.

Tissue Specificity :

Mainly expressed in brain. Also expressed in kidney. Not expressed in developing or adult lung.

Recommended Detection Systems :

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot.

Background :

Netrin receptor UNC5C is a protein that in humans is encoded by the UNC5C gene. This gene product belongs to the UNC-5 family of netrin receptors. Netrins are secreted proteins that direct axon extension and cell migration during neural development. They are bifunctional proteins that act as attractants for some cell types and as repellents for others, and these opposite actions are thought to be mediated by two classes of receptors. The UNC-5 family of receptors mediates the repellent response to netrin; they are transmembrane proteins containing 2 immunoglobulin (Ig)-like domains and 2 type I thrombospondin motifs in the extracellular region.

Research Category :

Axonal Guidance Proteins, Developmental Biology, Growth And Development, Nervous System Development, Neurogenesis, Neurology Process, Neuroscience, Organogenesis