Anti-STXBP2 Antibody Picoband™ | Boster PB9820 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-STXBP2 Antibody Picoband™

catalog :

PB9820

quantity :

100μg/vial

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot, immunocytochemistry, flow cytometry

product information

SKU :

PB9820

Product Name :

Anti-STXBP2 Antibody Picoband™

Size :

100μg/vial

Clonality :

Polyclonal

Host :

Rabbit

Reactivity :

Human, Mouse, Rat

Predicted Reactivity :

Hamster

Application(s) :

Flow Cytometry, IF, ICC, WB

Application Details :

Western blot, 0.1-0.5µg/ml, Human, Mouse, Rat. Immunocytochemistry/Immunofluorescence, 2µg/ml, Human. Flow Cytometry, 1-3μg/1x10^6 cells, Human.

Application Notes :

Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Description :

Boster Bio Anti-STXBP2 Antibody Picoband™ catalog # PB9820. Tested in Flow Cytometry, IF, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.

Concentration :

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

Gene Name :

STXBP2

Uniprot ID :

Q15833

Immunogen :

A synthetic peptide corresponding to a sequence at the N-terminus of human STXBP2 (184-215aa QEYPAIRYRKGPEDTAQLAHAVLAKLNAFKAD), different from the related mouse and rat sequences by one amino acid.

Form :

Lyophilized

Contents :

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purification :

Immunogen affinity purified.

Cross-reactivity :

No cross reactivity with other proteins

Storage :

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Gene Full Name :

Syntaxin-binding protein 2

Synonyms :

Syntaxin-binding protein 2; Protein unc-18 homolog 2; Unc18-2; Protein unc-18 homolog B; Unc-18B; STXBP2; UNC18B;

Protein Name :

Syntaxin-binding protein 2

Molecular Weight :

66453 MW

Protein Function :

Involved in intracellular vesicle trafficking and vesicle fusion with membranes. Contributes to the granule exocytosis machinery through interaction with soluble N- ethylmaleimide-sensitive factor attachment protein receptor (SNARE) proteins that regulate membrane fusion. Regulates cytotoxic granule exocytosis in natural killer (NK) cells.

Tissue Specificity :

Placenta, lung, liver, kidney and pancreas, as well as in peripheral blood lymphocytes.

Recommended Detection Systems :

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti- Rabbit IgG Super Vision Assay Kit (SV0002-1) for ICC.

Background :

Syntaxin-binding protein 2, also known as UNC18B, is a protein that in humans is encoded by the STXBP2 gene. The STXBP2 gene is mapped to human chromosome 19p13.3-p13.2 and to the proximal arm of mouse chromosome 8. And this gene encodes a member of the STXBP/unc-18/SEC1 family. The encoded protein is involved in intracellular trafficking, control of SNARE (soluble NSF attachment protein receptor) complex assembly, and the release of cytotoxic granules by natural killer cells. Additionally, UNC18B is expressed predominantly as a 2.4-kb message in placenta, lung, liver, kidney, and pancreas, as well as in peripheral blood lymphocytes. Mutations in this gene are associated with familial hemophagocytic lymphohistiocytosis. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.

Research Category :

Protein Trafficking, Signal Transduction, Vesicle Transport