This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Boster
product type :
antibody
product name :
Anti-RRM2 Antibody Picoband™
catalog :
PB9817
quantity :
100μg/vial
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry
product information
SKU :
PB9817
Product Name :
Anti-RRM2 Antibody Picoband™
Size :
100μg/vial
Clonality :
Polyclonal
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Application(s) :
IHC, WB
Application Details :
Immunohistochemistry (Paraffin-embedded Section), 0.5-1µg/ml, Human, By Heat. Western blot, 0.1-0.5µg/ml, Human, Mouse, Rat.
Application Notes :
Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.
Description :
Boster Bio Anti-RRM2 Antibody Picoband™ catalog # PB9817. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat.
Concentration :
Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Gene Name :
RRM2
Uniprot ID :
P31350
Immunogen :
A synthetic peptide corresponding to a sequence at the N-terminus of human RRM2 (1-33aa MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENT), different from the related mouse and rat sequences by eight amino acids.
Form :
Lyophilized
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Cross-reactivity :
No cross reactivity with other proteins.
Storage :
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Gene Full Name :
Ribonucleoside-diphosphate reductase subunit M2
Synonyms :
Ribonucleoside-diphosphate reductase subunit M2; 1.17.4.1; Ribonucleotide reductase small chain; Ribonucleotide reductase small subunit; RRM2; RR2;
Protein Name :
Ribonucleoside-diphosphate reductase subunit M2
Molecular Weight :
44878 MW
Protein Function :
Provides the precursors necessary for DNA synthesis. Catalyzes the biosynthesis of deoxyribonucleotides from the corresponding ribonucleotides. Inhibits Wnt signaling.
Subcellular Localization :
Cytoplasm
Recommended Detection Systems :
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).
Background :
Ribonucleoside-diphosphate reductase subunit M2, also known as ribonucleotide reductase small subunit, is an enzyme that in humans is encoded by the RRM2 gene. It is mapped to 2p25-p24. This gene encodes one of two non-identical subunits for ribonucleotide reductase. This reductase catalyzes the formation of deoxyribonucleotides from ribonucleotides. Synthesis of the encoded protein (M2) is regulated in a cell-cycle dependent fashion. Transcription from this gene can initiate from alternative promoters, which results in two isoforms which differ in the lengths of their N-termini. Related pseudogenes have been identified on chromosomes 1 and X.
Research Category :
DNA / RNA, DNA Synthesis, Epigenetics and Nuclear Signaling
company information
Boster
3942 B Valley Ave
Pleasanton, CA 94566
boster@bosterbio.com
https://www.bosterbio.com
925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits