Anti-Lck Antibody Picoband™ | Boster PB9808 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-Lck Antibody Picoband™

catalog :

PB9808

quantity :

100μg/vial

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot, immunocytochemistry, flow cytometry, immunohistochemistry - paraffin section, immunohistochemistry - frozen section

product information

SKU :

PB9808

Product Name :

Anti-Lck Antibody Picoband™

Size :

100μg/vial

Clonality :

Polyclonal

Host :

Rabbit

Reactivity :

Human, Mouse, Rat

Application(s) :

Flow Cytometry, IF, IHC-P, IHC-F, ICC, WB

Application Details :

Western blot, 0.1-0.5µg/ml, Human, Mouse. Immunohistochemistry (Paraffin-embedded Section), 0.5-1µg/ml, Human, Mouse, Rat, By Heat. Immunohistochemistry (Frozen Section), 0.5-1µg/ml, Mouse. Immunocytochemistry/Immunofluorescence, 2µg/ml, Human. Flow Cytometry, 1-3μg/1x10^6 cells, Human

Application Notes :

Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

Description :

Boster Bio Anti-Lck Antibody Picoband™ catalog # PB9808. Tested in Flow Cytometry, IF, IHC-P, IHC-F, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.

Concentration :

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

Gene Name :

LCK

Uniprot ID :

P06239

Immunogen :

A synthetic peptide corresponding to a sequence at the C-terminus of human Lck (468-506aa ELYQLMRLCWKERPEDRPTFDYLRSVLEDFFTATEGQYQ), different from the related mouse and rat sequences by three amino acids.

Form :

Lyophilized

Contents :

Each vial contains 4mg Trehalose, 0.9mg NaCl and 0.2mg Na2HPO4.

Purification :

Immunogen affinity purified.

Cross-reactivity :

No cross reactivity with other proteins.

Storage :

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Gene Full Name :

Tyrosine-protein kinase Lck

Synonyms :

Tyrosine-protein kinase Lck; 2.7.10.2; Leukocyte C-terminal Src kinase; LSK; Lymphocyte cell-specific protein-tyrosine kinase; Protein YT16; Proto-oncogene Lck; T cell-specific protein-tyrosine kinase; p56-LCK; LCK;

Protein Name :

Tyrosine-protein kinase Lck

Molecular Weight :

58001 MW

Protein Function :

Non-receptor tyrosine-protein kinase that plays an essential role in the selection and maturation of developing T- cells in the thymus and in the function of mature T-cells. Plays a key role in T-cell antigen receptor (TCR)-linked signal transduction pathways. Constitutively associated with the cytoplasmic portions of the CD4 and CD8 surface receptors. Association of the TCR with a peptide antigen-bound MHC complex facilitates the interaction of CD4 and CD8 with MHC class II and class I molecules, respectively, thereby recruiting the associated LCK protein to the vicinity of the TCR/CD3 complex. LCK then phosphorylates tyrosines residues within the immunoreceptor tyrosine-based activation motifs (ITAM) of the cytoplasmic tails of the TCR-gamma chains and CD3 subunits, initiating the TCR/CD3 signaling pathway. Once stimulated, the TCR recruits the tyrosine kinase ZAP70, that becomes phosphorylated and activated by LCK. Following this, a large number of signaling molecules are recruited, ultimately leading to lymphokine production. LCK also contributes to signaling by other receptor molecules. Associates directly with the cytoplasmic tail of CD2, which leads to hyperphosphorylation and activation of LCK. Also plays a role in the IL2 receptor-linked signaling pathway that controls the T-cell proliferative response. Binding of IL2 to its receptor results in increased activity of LCK. Is expressed at all stages of thymocyte development and is required for the regulation of maturation events that are governed by both pre-TCR and mature alpha beta TCR. Phosphorylates other substrates including RUNX3, PTK2B/PYK2, the microtubule-associated protein MAPT, RHOH or TYROBP.

Subcellular Localization :

Cytoplasm. Cell membrane ; Lipid-anchor ; Cytoplasmic side. Present in lipid rafts in an inactive form.

Tissue Specificity :

Expressed specifically in lymphoid cells.

Recommended Detection Systems :

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P), IHC(F) and ICC.

Background :

Lck (or lymphocyte-specific protein tyrosine kinase) is a 56 kDa protein that is found inside specializedcells of the immune system called lymphocytes. The human LCK gene is mapped to chromosome 1p35-p32. This gene is a member of the Src family of protein tyrosine kinases (PTKs). The encoded protein is a key signaling molecule in the selection and maturation of developing T-cells. It contains N-terminal sites for myristylation and palmitylation, a PTK domain, and SH2 and SH3 domains which are involved in mediating protein-protein interactions with phosphotyrosine-containing and proline-rich motifs, respectively. The protein localizes to the plasma membrane and pericentrosomal vesicles, and binds to cell surface receptors, including CD4 and CD8, and other signaling molecules. Multiple alternatively spliced variants, encoding the same protein, have been described.

Research Category :

Adaptive Immunity, Immunoglobulins, Immunology, Protein Phosphorylation, Receptors, Secreted Molecules, Signal Transduction, T Cells, Tyrosine Kinases