This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Boster
product type :
antibody
product name :
Anti-CD45/PTPRC Antibody Picoband™
catalog :
PB9785
quantity :
100μg/vial
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot, immunocytochemistry, flow cytometry, immunohistochemistry - paraffin section, immunohistochemistry - frozen section
product information
SKU :
PB9785
Product Name :
Anti-CD45/PTPRC Antibody Picoband™
Size :
100μg/vial
Clonality :
Polyclonal
Host :
Rabbit
Reactivity :
Human
Application(s) :
Flow Cytometry, IF, IHC-P, IHC-F, WB
Application Details :
Western blot, 0.1-0.5µg/ml, Human.
Immunohistochemistry (Paraffin-embedded Section), 0.5-1µg/ml, Human, By Heat.
Immunohistochemistry (Frozen Section), 0.5-1µg/ml, Human.
Immunofluorescence, 2µg/ml, Human.
Flow Cytometry, 1-3µg/1x10^6 cells, Human
Application Notes :
Tested Species: In-house tested species with positive results.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Description :
Boster Bio Anti-CD45/PTPRC Antibody Picoband™ catalog # PB9785. Tested in Flow Cytometry, IF, IHC-P, IHC-F, WB applications. This antibody reacts with Human.
Concentration :
Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Gene Name :
PTPRC
Uniprot ID :
P08575
Immunogen :
different from the related mouse sequence by eight amino acids, and from the related rat sequence by ten amino acids.
EQYQFLYDVIASTYPAQNGQVKKNNHQEDKIEFDNEVDK
VK),
A synthetic peptide corresponding to a sequence at the C-terminus of human CD45 (1214-1254aa
EQYQFLYDVIASTYPAQNGQVKKNNHQEDKIEFDNEVDK
VK),
A synthetic peptide corresponding to a sequence at the C-terminus of human CD45 (1214-1254aa
Form :
Lyophilized
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Cross-reactivity :
No cross reactivity with other proteins.
Storage :
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Gene Full Name :
Receptor-type tyrosine-protein phosphatase C
Synonyms :
Receptor-type tyrosine-protein phosphatase C; 3.1.3.48; Leukocyte common antigen; L-CA; T200; CD45; PTPRC; CD45;
Protein Name :
Receptor-type tyrosine-protein phosphatase C
Molecular Weight :
147254 MW
Protein Function :
Protein tyrosine-protein phosphatase required for T-cell activation through the antigen receptor. Acts as a positive regulator of T-cell coactivation upon binding to DPP4. The first PTPase domain has enzymatic activity, while the second one seems to affect the substrate specificity of the first one. Upon T-cell activation, recruits and dephosphorylates SKAP1 and FYN. Dephosphorylates LYN, and thereby modulates LYN activity (By similarity).
Subcellular Localization :
Membrane ; Single-pass type I membrane protein. Membrane raft. Colocalized with DPP4 in membrane rafts.
Recommended Detection Systems :
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P) and IHC(F).
Background :
CD45 (Cluster of Differentiation 45), also known as PTPRC, LCA or CD45R, is an enzyme that, in humans, is encoded by the PTPRC gene. It is a member of the protein tyrosine phosphatase (PTP) family. CD45 is a major high molecular mass leukocyte cell surface molecule which is also an integral membrane protein tyrosine phosphatase. The cytogenetic location of CD45 is 1q31.3-q32.1. This gene is especially a prototype for transmembrane protein-tyrosine phosphatase (PTP). Targeted disruption of the CD45 gene leads to enhanced cytokine and interferon receptor-mediated activation of JAKs and STAT proteins. In vitro, CD45 directly dephosphorylates and binds to JAKs. Functionally, CD45 negatively regulates interleukin-3-mediated cellular proliferation, erythropoietin-dependent hematopoiesis, and antiviral responses in vitro and in vivo. In addition, CD45 has been best studied in T cells, where it determines T cell receptor signaling thresholds. CD45 is moved into or out of the immunological synapse (IS) membrane microdomain depending on the relative influence of interaction with the extracellular galectin lattice or the intracellular actin cytoskeleton. Galectin interaction can be finetuned by varying usage of the heavily Oglycosylated spliced regions and sialylation of Nlinked carbohydrates.
Research Category :
Adapters, Adaptive Immunity, B Cells, Cell Type Markers, Immunology, Protein Phosphorylation, Signal Transduction, T Cells, Transmembrane, Tyrosine Phosphatases
company information
Boster
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
https://www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
questions and comments
