Anti-Prolactin Receptor/PRLR Antibody Picoband™ | Boster PB9782 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-Prolactin Receptor/PRLR Antibody Picoband™

catalog :

PB9782

quantity :

100μg/vial

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human

application :

western blot

product information

SKU :

PB9782

Product Name :

Anti-Prolactin Receptor/PRLR Antibody Picoband™

Size :

100μg/vial

Clonality :

Polyclonal

Host :

Rabbit

Reactivity :

Human

Application(s) :

Application Details :

Western blot, 0.1-0.5µg/ml, Human.

Application Notes :

Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Description :

Boster Bio Anti-Prolactin Receptor/PRLR Antibody Picoband™ catalog # PB9782. Tested in WB applications. This antibody reacts with Human.

Concentration :

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

Gene Name :

PRLR

Uniprot ID :

P16471

Immunogen :

different from the related mouse sequence by eleven amino acids, and from the related rat sequence by fourteen amino aci
HAKNVACFEESAKEAPPSLEQNQAEKALANFTATSSKCR
LQ),
A synthetic peptide corresponding to a sequence at the C-terminus of human PRLR (565-605aa

Form :

Lyophilized

Contents :

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purification :

Immunogen affinity purified.

Cross-reactivity :

No cross reactivity with other proteins.

Storage :

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Gene Full Name :

Prolactin receptor

Synonyms :

Prolactin receptor; PRL-R; PRLR;

Protein Name :

Prolactin receptor

Molecular Weight :

69506 MW

Protein Function :

This is a receptor for the anterior pituitary hormone prolactin (PRL). Acts as a prosurvival factor for spermatozoa by inhibiting sperm capacitation through suppression of SRC kinase activation and stimulation of AKT. Isoform 4 is unable to transduce prolactin signaling. Isoform 6 is unable to transduce prolactin signaling.

Subcellular Localization :

Membrane ; Single-pass type I membrane protein.

Tissue Specificity :

Expressed in breast, placenta, kidney, liver and pancreas.

Recommended Detection Systems :

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot.

Background :

PRLR (Prolactin Receptor) is a cytokine receptor. By somatic cell hybrid analysis and by in situ hybridization, Arden et al. (1989, 1990) demonstrated that the prolactin receptor gene resides in the same chromosomal region as the growth hormone receptor gene, which has been mapped to 5p13-p12. Cunningham et al. (1990) demonstrated that zinc greatly increases the affinity of GH for the extracellular binding domain of PRLR, although it is not required for binding of GH to the growth hormone receptor or for binding of prolactin to the prolactin receptor. By mutational analysis, they showed that a cluster of 3 residues (histidine-18, histidine-21, and glutamic acid-174) in GH and histidine-188 in PRLR (conserved in all PRL receptors but not GH receptors) are likely zinc-ion ligands.

Research Category :

Cell Biology, Cell Cycle, Cell Differentiation, Growth Factors/Hormones, Signal Transduction