Anti-Phospholipase A2/PLA2G4A Antibody Picoband™ | Boster PB9778 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-Phospholipase A2/PLA2G4A Antibody Picoband™

catalog :

PB9778

quantity :

100μg/vial

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse

application :

western blot

product information

SKU :

PB9778

Product Name :

Anti-Phospholipase A2/PLA2G4A Antibody Picoband™

Size :

100μg/vial

Clonality :

Polyclonal

Host :

Rabbit

Reactivity :

Human, Mouse

Application(s) :

Application Details :

Western blot, 0.1-0.5µg/ml, Human, Mouse.

Application Notes :

Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Description :

Boster Bio Anti-Phospholipase A2/PLA2G4A Antibody Picoband™ catalog # PB9778. Tested in WB applications. This antibody reacts with Human, Mouse.

Concentration :

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

Gene Name :

PLA2G4A

Uniprot ID :

P47712

Immunogen :

different from the related mouse and rat sequences by three amino acids.
NFQYPNQAFKRLHDLMHFNTLNNIDVIKEAMVESIEYRR
Q),
A synthetic peptide corresponding to a sequence at the C-terminus of human PLA2G4A (682-721aa

Form :

Lyophilized

Contents :

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purification :

Immunogen affinity purified.

Cross-reactivity :

No cross reactivity with other proteins.

Storage :

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Gene Full Name :

Cytosolic phospholipase A2

Synonyms :

Cytosolic phospholipase A2; cPLA2; Phospholipase A2 group IVA; Phospholipase A2; 3.1.1.4; Phosphatidylcholine 2-acylhydrolase; Lysophospholipase; 3.1.1.5; PLA2G4A; CPLA2, PLA2G4;

Protein Name :

Cytosolic phospholipase A2

Molecular Weight :

85239 MW

Protein Function :

Selectively hydrolyzes arachidonyl phospholipids in the sn-2 position releasing arachidonic acid. Together with its lysophospholipid activity, it is implicated in the initiation of the inflammatory response.

Subcellular Localization :

Cytoplasm. Cytoplasmic vesicle. Translocates to membrane vesicles in a calcium-dependent fashion.

Tissue Specificity :

Expressed in various tissues such as macrophages, platelets, neutrophils, fibroblasts and lung endothelium.

Recommended Detection Systems :

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot.

Background :

PLA2G4A (Phospholipase A2, Group IVA), is an enzyme that in humans is encoded by the PLA2G4A gene. Tay et al. (1995) mapped the PLA2G4A gene to rat chromosome 13 by PCR-based intercross genotyping and to human 1q25 by fluorescence in situ hybridization. By site-directed mutagenesis and biochemical analysis of the recombinant protein, Sharp et al. (1994) determined that ser228 participates in the catalytic mechanism of cPLA2 and that both the phospholipase A2 and the lysophospholipase activities are catalyzed by the same active site residue (s). PLA2G4A, the cytosolic phospholipase A2, appears to subserve transmembrane signaling responses to extracellular ligands (Skorecki, 1995).

Research Category :

Atherosclerosis, Cancer, Cardiovascular, Heart Disease, Immunology, Innate Immunity, Lipid And Lipoprotein Metabolism, Lipid Signaling, Macrophage / Inflamm., Metabolic Signaling Pathways, Metabolism, Pathways And Processes, Signal Transduction, Signaling Pathway, Vascular Inflammation