This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Boster
product type :
antibody
product name :
Anti-Mineralocorticoid Receptor/NR3C2 Antibody Picoband™
catalog :
PB9765
quantity :
100μg/vial
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot
product information
SKU :
PB9765
Product Name :
Anti-Mineralocorticoid Receptor/NR3C2 Antibody Picoband™
Size :
100μg/vial
Clonality :
Polyclonal
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Predicted Reactivity :
Chicken
Application(s) :
WB
Application Details :
Western blot, 0.1-0.5µg/ml, Human, Mouse, Rat.
Application Notes :
Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
Description :
Boster Bio Anti-Mineralocorticoid Receptor/NR3C2 Antibody Picoband™ catalog # PB9765. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.
Concentration :
Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Gene Name :
NR3C2
Uniprot ID :
P08235
Immunogen :
A synthetic peptide corresponding to a sequence at the C-terminus of human NR3C2 (950-984aa HALKVEFPAMLVEIISDQLPKVESGNAKPLYFHRK), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids.
Form :
Lyophilized
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Cross-reactivity :
No cross reactivity with other proteins.
Storage :
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Gene Full Name :
Mineralocorticoid receptor
Synonyms :
Mineralocorticoid receptor; MR; Nuclear receptor subfamily 3 group C member 2; NR3C2; MCR, MLR;
Protein Name :
Mineralocorticoid receptor
Molecular Weight :
107067 MW
Protein Function :
Receptor for both mineralocorticoids (MC) such as aldosterone and glucocorticoids (GC) such as corticosterone or cortisol. Binds to mineralocorticoid response elements (MRE) and transactivates target genes. The effect of MC is to increase ion and water transport and thus raise extracellular fluid volume and blood pressure and lower potassium levels.
Subcellular Localization :
Cytoplasm. Nucleus. Endoplasmic reticulum membrane; Peripheral membrane protein. Cytoplasmic and nuclear in the absence of ligand; nuclear after ligand-binding. When bound to HSD11B2, it is found associated with the endoplasmic reticulum membrane.
Tissue Specificity :
Ubiquitous. Highly expressed in distal tubules, convoluted tubules and cortical collecting duct in kidney, and in sweat glands. Detected at lower levels in cardiomyocytes, in epidermis and in colon enterocytes.
Recommended Detection Systems :
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot.
Background :
NR3C2 (nuclear receptor subfamily 3, group C, member 2), also known as MR (mineralocorticoid receptor), is a protein that in humans is encoded by the NR3C2 gene that is located on chromosome 4q31.1-31.2. It belongs to the nuclear receptor family where the ligand diffuses into cells, interacts with the receptor and results in a signal transduction affecting specific gene expression in the nucleus. This gene encodes the mineralocorticoid receptor, which mediates aldosterone actions on salt and water balance within restricted target cells. The protein functions as a ligand-dependent transcription factor that binds to mineralocorticoid response elements in order to transactivate target genes. Mutations in this gene cause autosomal dominant pseudohypoaldosteronism type I, a disorder characterized by urinary salt wasting. Defects in this gene are also associated with early onset hypertension with severe exacerbation in pregnancy. Alternative splicing results in multiple transcript variants.
Research Category :
Atherosclerosis, Cardiovascular, Domain Families, Epigenetics and Nuclear Signaling, Hypertrophy, Nuclear Hormone Receptors, Nuclear Receptors, Nuclear Signaling Pathways, Signal Transduction, Signaling Pathway, Transcription, Zinc Finger
company information
Boster
3942 B Valley Ave
Pleasanton, CA 94566
boster@bosterbio.com
https://www.bosterbio.com
925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits