Anti-Myosin Phosphatase/PPP1R12A Antibody Picoband™ | Boster PB9737 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-Myosin Phosphatase/PPP1R12A Antibody Picoband™

catalog :

PB9737

quantity :

100μg/vial

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse

application :

western blot, immunocytochemistry, flow cytometry, immunohistochemistry - paraffin section

product information

SKU :

PB9737

Product Name :

Anti-Myosin Phosphatase/PPP1R12A Antibody Picoband™

Size :

100μg/vial

Clonality :

Polyclonal

Host :

Rabbit

Reactivity :

Human, Monkey, Mouse, Rat

Predicted Reactivity :

Bovine, Canine, Chicken, Horse, Monkey, Rabbit

Application(s) :

Flow Cytometry, IF, IHC-P, ICC, WB

Application Details :

Western blot, 0.1-0.5µg/ml, Human, Mouse, Rat, Monkey. Immunohistochemistry (Paraffin-embedded Section), 0.5-1µg/ml, Human, By Heat. Immunocytochemistry/Immunofluorescence, 2µg/ml, Human. Flow Cytometry, 1-3μg/1x10^6 cells, Human

Application Notes :

Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

Description :

Boster Bio Anti-Myosin Phosphatase/PPP1R12A Antibody Picoband™ catalog # PB9737. Tested in Flow Cytometry, IF, IHC-P, ICC, WB applications. This antibody reacts with Human, Monkey, Mouse, Rat.

Concentration :

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

Gene Name :

PPP1R12A

Uniprot ID :

O14974

Immunogen :

identical to the related mouse and rat sequences.
MKMADAKQKRNEQLKRWIGSETDLEPPVVKRQKTKVKFD
D),
A synthetic peptide corresponding to a sequence at the N-terminus of human PPP1R12A (1-40aa

Form :

Lyophilized

Contents :

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purification :

Immunogen affinity purified.

Cross-reactivity :

No cross reactivity with other proteins.

Storage :

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Gene Full Name :

Protein phosphatase 1 regulatory subunit 12A

Synonyms :

Protein phosphatase 1 regulatory subunit 12A; Myosin phosphatase-targeting subunit 1; Myosin phosphatase target subunit 1; Protein phosphatase myosin-binding subunit; PPP1R12A; MBS, MYPT1;

Protein Name :

Protein phosphatase 1 regulatory subunit 12A

Molecular Weight :

115281 MW

Protein Function :

Key regulator of protein phosphatase 1C (PPP1C). Mediates binding to myosin. As part of the PPP1C complex, involved in dephosphorylation of PLK1. Capable of inhibiting HIF1AN- dependent suppression of HIF1A activity.

Subcellular Localization :

Cytoplasm. Along actomyosin filaments and stress fibers.

Tissue Specificity :

Expressed in striated muscles, specifically in type 2a fibers (at protein level).

Recommended Detection Systems :

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P) and ICC.

Background :

PPP1R12A (Protein phosphatase 1 regulatory subunit 12A), also called MYPT1 (Myosin phosphatase target subunit 1), is an enzyme that in humans is encoded by the PPP1R12A gene. PPP1R12A is one of the subunits of myosin phosphatase. Sequencing analysis showed that human PPP1R12A contains 1,030 amino acids with a calculated molecular mass of approximately 115 kD. The PPP1R12A gene is mapped on 12q21.2-q21.3. PPP1R12A is the protein that regulates PP1 function in smooth muscle relaxation. The cellular MYPT1-PP1-delta -specific inhibitor CPI17 caused a loss of merlin function characterized by merlin phosphorylation, Ras activation, and transformation. Jin et al. concluded that PPP1R12A and its substrate merlin are part of a previously undescribed tumor suppressor cascade that can be hindered in two ways, by mutation of the NF2 gene and by upregulation of the oncoprotein CPI17.

Research Category :

Actin Assembly, Actin Etc, Cytoskeleton, Cytoskeleton / Ecm, Microfilaments, Motor Proteins, Myosin, Signal Transduction