Anti-Cytochrome P450 Reductase/POR Antibody Picoband™

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-Cytochrome P450 Reductase/POR Antibody Picoband™

catalog :

PB9736

quantity :

100μg/vial

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry, immunocytochemistry, flow cytometry

product information

SKU :

PB9736

Product Name :

Anti-Cytochrome P450 Reductase/POR Antibody Picoband™

Size :

100μg/vial

Clonality :

Polyclonal

Host :

Rabbit

Reactivity :

Human, Mouse, Rat

Application(s) :

Flow Cytometry, IHC, ICC, WB

Application Details :

Immunohistochemistry (Paraffin-embedded Section), 0.5-1µg/ml, Human, Mouse, Rat, By Heat. Western blot, 0.1-0.5µg/ml, Human, Mouse, RatImmunohistochemistry (Frozen Section), 0.5-1µg/ml, Human. Immunocytochemistry, 0.5-1µg/ml, Human. Flow Cytometry, 1-3μg/1x10^6 cells, Human

Application Notes :

Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

Description :

Boster Bio Anti-Cytochrome P450 Reductase/POR Antibody Picoband™ catalog # PB9736. Tested in Flow Cytometry, IHC, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.

Concentration :

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

Gene Name :

POR

Uniprot ID :

P16435

Immunogen :

A synthetic peptide corresponding to a sequence at the C-terminus of human POR (633-668aa RNMARDVQNTFYDIVAELGAMEHAQAVDYIKKLMTK), different from the related mouse and rat sequences by five amino acids.

Form :

Lyophilized

Contents :

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purification :

Immunogen affinity purified.

Cross-reactivity :

No cross reactivity with other proteins.

Storage :

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Gene Full Name :

NADPH--cytochrome P450 reductase

Synonyms :

NADPH--cytochrome P450 reductase; CPR; P450R; 1.6.2.4; POR; CYPOR;

Protein Name :

NADPH--cytochrome P450 reductase

Molecular Weight :

76690 MW

Protein Function :

This enzyme is required for electron transfer from NADP to cytochrome P450 in microsomes. It can also provide electron transfer to heme oxygenase and cytochrome B5.

Subcellular Localization :

Endoplasmic reticulum membrane; Peripheral membrane protein. Anchored to the ER membrane by its N- terminal hydrophobic region.

Recommended Detection Systems :

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P), IHC(F) and ICC.

Background :

POR is a membrane-boundenzyme required for electron transfer from NADPH to cytochrome P450 in the endoplasmic reticulum of theeukaryotic cell. The gene encodes an endoplasmic reticulum membrane oxidoreductase with an FAD-binding domain and a flavodoxin-like domain. The protein binds two cofactors, FAD and FMN, which allow it to donate electrons directly from NADPH to all microsomal P450 enzymes. Mutations in this gene have been associated with various diseases, including apparent combined P450C17 and P450C21 deficiency, amenorrhea and disordered steroidogenesis, congenital adrenal hyperplasia and Antley-Bixler syndrome.

Research Category :

Cancer, Metabolism, Mitochondria, Mitochondrial, Mitochondrial Markers, Mitochondrial Metabolism, Organelles, Pathways And Processes, Signal Transduction, Subcellular Markers