Anti-Caseine Kinase 1 alpha/CSNK1A1 Antibody Picoband™

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-Caseine Kinase 1 alpha/CSNK1A1 Antibody Picoband™

catalog :

PB9693

quantity :

100μg/vial

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry

product information

SKU :

PB9693

Product Name :

Anti-Caseine Kinase 1 alpha/CSNK1A1 Antibody Picoband™

Size :

100μg/vial

Clonality :

Polyclonal

Host :

Rabbit

Reactivity :

Human, Mouse, Rat

Predicted Reactivity :

Chicken

Application(s) :

IHC, WB

Application Details :

Immunohistochemistry (Paraffin-embedded Section), 0.5-1µg/ml, Human, Mouse, Rat, By Heat. Western blot, 0.1-0.5µg/ml, Human, Mouse, Rat.

Application Notes :

Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

Description :

Boster Bio Anti-Caseine Kinase 1 alpha/CSNK1A1 Antibody Picoband™ catalog # PB9693. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat.

Concentration :

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

Gene Name :

CSNK1A1

Uniprot ID :

P48729

Immunogen :

A synthetic peptide corresponding to a sequence at the N-terminus of human CSNK1A1 (30-68aa DIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQ), identical to the related mouse and rat sequences.

Form :

Lyophilized

Contents :

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purification :

Immunogen affinity purified.

Cross-reactivity :

No cross reactivity with other proteins

Storage :

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Gene Full Name :

Casein kinase I isoform alpha

Synonyms :

Casein kinase I isoform alpha; CKI-alpha; 2.7.11.1; CK1; CSNK1A1;

Protein Name :

Casein kinase I isoform alpha

Molecular Weight :

38915 MW

Protein Function :

Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. It can phosphorylate a large number of proteins. Participates in Wnt signaling. Phosphorylates CTNNB1 at 'Ser-45'. May phosphorylate PER1 and PER2. May play a role in segregating chromosomes during mitosis (PubMed:11955436, PubMed:1409656, PubMed:18305108). May play a role in keratin cytoskeleton disassembly and thereby, it may regulate epithelial cell migration (PubMed:23902688).

Subcellular Localization :

Cytoplasm. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Chromosome, centromere, kinetochore. Nucleus speckle. Localizes to the centrosome in interphase cells, and to kinetochore fibers during mitosis. Also recruited to the keratin cytoskeleton (PubMed:23902688).

Recommended Detection Systems :

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).

Background :

Casein kinase I isoform alpha is an enzyme that in humans is encoded by the CSNK1A1 gene. The CSNK1A1 gene is mapped to chromosome 5q32 based on an alignment of the CSNK1A1 sequence with the genomic sequence (GRCh37). It is reported that both screens identified CK1-alpha as a bifunctional regulator of NF-kappa-B. CK1-alpha dynamically associates with the CBM complex on T cell receptor engagement to participate in cytokine production and lymphocyte proliferation. However, CK1-alpha kinase activity has a contrasting role by subsequently promoting the phosphorylation and inactivation of CARMA1. CK1-alpha has thus a dual 'gating' function which first promotes and then terminates receptor-induced NF-kappa-B. ABC DLBCL cells required CK1-alpha for constitutive NF-kappa-B activity, indicating that CK1-alpha functions as a conditionally essential malignancy gene.