Anti-BMP4 Antibody Picoband™ | Boster PB9688 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-BMP4 Antibody Picoband™

catalog :

PB9688

quantity :

100μg/vial

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse

application :

western blot, ELISA

product information

SKU :

PB9688

Product Name :

Anti-BMP4 Antibody Picoband™

Size :

100μg/vial

Clonality :

Polyclonal

Host :

Rabbit

Reactivity :

Human, Mouse

Predicted Reactivity :

Bovine

Application(s) :

ELISA, WB

Application Details :

ELISA, 0.1-0.5µg/ml, Human, Mouse Western blot, 0.1-0.5µg/ml, Human, Mouse.

Application Notes :

Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Description :

Boster Bio Anti-BMP4 Antibody Picoband™ catalog # PB9688. Tested in ELISA, WB applications. This antibody reacts with Human, Mouse.

Concentration :

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

Gene Name :

BMP4

Uniprot ID :

P12644

Immunogen :

A synthetic peptide corresponding to a sequence at the C-terminus of human BMP-4 (293-324aa SPKHHSQRARKKNKNCRRHSLYVDFSDVGWND), different from the related mouse and rat sequences by two amino acids.

Form :

Lyophilized

Contents :

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purification :

Immunogen affinity purified.

Cross-reactivity :

No cross reactivity with other proteins

Storage :

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Gene Full Name :

Bone morphogenetic protein 4

Synonyms :

Bone morphogenetic protein 4; BMP-4; Bone morphogenetic protein 2B; BMP-2B; BMP4; BMP2B, DVR4;

Protein Name :

Bone morphogenetic protein 4

Molecular Weight :

46555 MW

Protein Function :

Induces cartilage and bone formation. Also act in mesoderm induction, tooth development, limb formation and fracture repair. Acts in concert with PTHLH/PTHRP to stimulate ductal outgrowth during embryonic mammary development and to inhibit hair follicle induction (By similarity).

Subcellular Localization :

Secreted, extracellular space, extracellular matrix.

Tissue Specificity :

Expressed in the lung and lower levels seen in the kidney. Present also in normal and neoplastic prostate tissues, and prostate cancer cell lines.

Recommended Detection Systems :

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot.

Background :

Bone morphogenetic protein 4 is a protein that in humans is encoded by BMP4 gene. It is found on chromosome 14q22-q23. The protein encoded by this gene is a member of the bone morphogenetic protein family which is part of the transforming growth factor-beta superfamily. The superfamily includes large families of growth and differentiation factors. Bone morphogenetic proteins were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. This particular family member plays an important role in the onset of endochondral bone formation in humans, and a reduction in expression has been associated with a variety of bone diseases, including the heritable disorder Fibrodysplasia Ossificans Progressiva. Alternative splicing in the 5' untranslated region of this gene has been described and three variants are described, all encoding an identical protein.

Research Category :

Angiogenesis, Cancer, Cardiovascular, Developmental Biology, Growth Factors, Growth Factors/Hormones, Nervous System Development, Organogenesis, Secreted, Signal Transduction, Signaling Pathways, Stem Cells, Tgf Beta