This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Boster
product type :
antibody
product name :
Anti-GRK3/ADRBK2 Antibody Picoband™
catalog :
PB9682
quantity :
100μg/vial
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot, immunocytochemistry, flow cytometry
product information
SKU :
PB9682
Product Name :
Anti-GRK3/ADRBK2 Antibody Picoband™
Size :
100μg/vial
Clonality :
Polyclonal
Host :
Rabbit
Reactivity :
Human
Application(s) :
Flow Cytometry, IF, ICC, WB
Application Details :
Western blot, 0.1-0.5µg/ml, Human.
Immunocytochemistry/Immunofluorescence, 2µg/ml, Human.
Flow Cytometry, 1-3μg/1x10^6 cells, Human
Application Notes :
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Description :
Boster Bio Anti-GRK3/ADRBK2 Antibody Picoband™ catalog # PB9682. Tested in Flow Cytometry, IF, ICC, WB applications. This antibody reacts with Human.
Concentration :
Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Gene Name :
ADRBK2
Uniprot ID :
P35626
Immunogen :
A synthetic peptide corresponding to a sequence at the C-terminus of human GRK3 (635-669aa ESDPEFVQWKKELNETFKEAQRLLRRAPKFLNKPR), different from the related mouse and rat sequences by five amino acids.
Form :
Lyophilized
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Cross-reactivity :
No cross reactivity with other proteins
Storage :
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Gene Full Name :
Beta-adrenergic receptor kinase 2
Synonyms :
Beta-adrenergic receptor kinase 2; Beta-ARK-2; 2.7.11.15; G-protein-coupled receptor kinase 3; ADRBK2; BARK2, GRK3;
Protein Name :
Beta-adrenergic receptor kinase 2
Molecular Weight :
79710 MW
Protein Function :
Specifically phosphorylates the agonist-occupied form of the beta-adrenergic and closely related receptors.
Recommended Detection Systems :
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for ICC.
Background :
Beta-adrenergic receptor kinase 2 (beta-ARK-2), also known as G-protein-coupled receptor kinase 3 (GRK3), is an enzyme that in humans is encoded by the ADRBK2 gene. The human ADRBK2 gene is located on 22q11. The beta-adrenergic receptor kinase specifically phosphorylates the agonist-occupied form of the beta-adrenergic and related G protein-coupled receptors. Overall, the beta adrenergic receptor kinase 2 has 85% amino acid similarity with beta adrenergic receptor kinase 1, with the protein kinase catalytic domain having 95% similarity. These data suggest the existence of a family of receptor kinases which may serve broadly to regulate receptor function.
Research Category :
Ser / Thr Kinases, Signal Transduction, Signaling Pathway
company information
Boster
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
https://www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
questions and comments