Anti-MMP9 Antibody Picoband™ | Boster PB9668 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-MMP9 Antibody Picoband™

catalog :

PB9668

quantity :

100μg/vial

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human

application :

western blot, ELISA, immunohistochemistry - paraffin section

product information

SKU :

PB9668

Product Name :

Anti-MMP9 Antibody Picoband™

Size :

100μg/vial

Clonality :

Polyclonal

Host :

Rabbit

Reactivity :

Human

Application(s) :

ELISA, IHC-P, WB

Application Details :

Western blot, 0.1-0.5µg/ml, Human. Immunohistochemistry(Paraffin-embedded Section), 2-5 μg/ml, Human. ELISA, 0.1-0.5µg/ml, Human.

Application Notes :

Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Description :

Boster Bio Anti-MMP9 Antibody Picoband™ catalog # PB9668. Tested in ELISA, IHC-P, WB applications. This antibody reacts with Human.

Concentration :

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

Gene Name :

MMP9

Uniprot ID :

P14780

Immunogen :

A synthetic peptide corresponding to a sequence at the C-terminus of human MMP-9 (633-667aa WRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQY), different from the related mouse sequence by fourteen amino acids, and from the related rat sequence by sixteen amino acids.

Form :

Lyophilized

Contents :

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purification :

Immunogen affinity purified.

Cross-reactivity :

No cross reactivity with other proteins

Storage :

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Gene Full Name :

Matrix metalloproteinase-9

Synonyms :

Matrix metalloproteinase-9; MMP-9; 3.4.24.35; 92 kDa gelatinase; 92 kDa type IV collagenase; Gelatinase B; GELB; 67 kDa matrix metalloproteinase-9; 82 kDa matrix metalloproteinase-9; MMP9; CLG4B;

Protein Name :

Matrix metalloproteinase-9

Molecular Weight :

78458 MW

Protein Function :

May play an essential role in local proteolysis of the extracellular matrix and in leukocyte migration. Could play a role in bone osteoclastic resorption. Cleaves KiSS1 at a Gly- -Leu bond. Cleaves type IV and type V collagen into large C-terminal three quarter fragments and shorter N-terminal one quarter fragments. Degrades fibronectin but not laminin or Pz-peptide.

Subcellular Localization :

Secreted, extracellular space, extracellular matrix.

Tissue Specificity :

Produced by normal alveolar macrophages and granulocytes.

Recommended Detection Systems :

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).

Background :

Matrix metallopeptidase 9 (MMP-9), also known as 92 kDa type IV collagenase, 92 kDa gelatinase or gelatinase B (GELB), is an enzyme that in humans is encoded by the MMP9 gene. Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes. Most MMPs are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The enzyme encoded by this gene degrades type IV and V collagens. Studies in rhesus monkeys suggest that the enzyme is involved in IL-8-induced mobilization of hematopoietic progenitor cells from bone marrow, and murine studies suggest a role in tumor-associated tissue remodeling.

Research Category :

Angiogenesis, Atherosclerosis, Cancer, Cardiovascular, Cell Biology, Cytoskeleton / Ecm, Ecm Enzymes, Extracellular Matrix, Invasion/Microenvironment, Metalloprotease, Proteolysis / Ubiquitin, Proteolytic Enzymes, Signal Transduction, Tumor Biomarkers