Anti-galectin 9/LGALS9 Picoband Antibody | Boster PB9660 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-galectin 9/LGALS9 Picoband Antibody

catalog :

PB9660

quantity :

100 ug/vial

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human

application :

western blot

product information

sku :

PB9660

status :

Enabled

name :

Anti-galectin 9/LGALS9 Picoband Antibody

category name :

Primary Antibodies, Polyclonal Antibodies

gene name :

LGALS9

price various sizes :

30ug sample size / $99 100ug / $240 100ug+Free HRP Secondary BA1054 / $240 100ug+Free Biotin Secondary BA1003 / $240

clonality :

Polyclonal

concentration :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

conjugate :

contents :

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na 2 HPO 4 , 0.05mg NaN 3 .

description :

Polyclonal antibody for GALECTIN 9/LGALS9 detection. Host: Rabbit.Size: 100ug/vial. Tested applications: WB. Reactive species: Human. GALECTIN 9/LGALS9 information: Molecular Weight: 39518 MW; Subcellular Localization: Cytoplasm . Secreted . May also be secreted by a non-classical secretory pathway; Tissue Specificity: Peripheral blood leukocytes and lymphatic tissues. Overexpressed in Hodgkin disease tissue.

short description :

Rabbit IgG polyclonal antibody for galectin 9(LGALS9) detection. Tested with WB in Human;Rat.

size :

100 ug/vial

sample size available :

30ug for $99, contact us for details

uniprot id :

O00182

host :

Rabbit

immunogen :

A synthetic peptide corresponding to a sequence at the C-terminus of human galectin 9 (322-355aa DGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT), different from the related mouse sequence by eight amino acids, and from the related rat sequence by six amino acids.

form :

Lyophilized

purification :

Immunogen affinity purified.

storage :

At -20 C for one year. After reconstitution, at 4 C for one month. It can also be aliquotted and stored frozen at -20 C for a longer time.Avoid repeated freezing and thawing.

cross reactivity :

No cross reactivity with other proteins

reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

application details :

Western blot, 0.1-0.5ug/ml, Rat, Human.

applications :

reactivity :

Human, Rat

image labels :

Anti- galectin 9 Picoband antibody, PB9660, Western blotting. All lanes: Anti galectin 9 (PB9660) at 0.5ug/ml. WB: Rat Gaster Tissue Lysate at 50ug. Predicted bind size: 40KD. Observed bind size: 36KD

background :

Galectin-9 is a protein that in humans is encoded by the LGALS9 gene. It is mapped to 17q11.2. The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. The protein encoded by this gene is an S-type lectin. It is overexpressed in Hodgkin's disease tissue and might participate in the interaction between the H&RS cells with their surrounding cells and might thus play a role in the pathogenesis of this disease and / or its associated immunodeficiency. Multiple alternatively spliced transcript variants have been found for this gene.

competitor equivalent skus :

sc 292682

research category :

Cell Biology

synonyms :

Galectin-9;Gal-9;Ecalectin;Tumor antigen HOM-HD-21;LGALS9;

gene full name :

Galectin-9

molecular weight :

39518 MW

protein function :

Binds galactosides. Has high affinity for the Forssman pentasaccharide. May play a role in thymocyte-epithelial interactions relevant to the biology of the thymus. Inhibits cell proliferation. It is a ligand for HAVCR2/TIM3. Induces T-helper type 1 lymphocyte (Th1) death. Isoform Short acts as an eosinophil chemoattractant.

subcellular localization :

Cytoplasm . Secreted . May also be secreted by a non-classical secretory pathway.

tissue specificity :

Peripheral blood leukocytes and lymphatic tissues. Overexpressed in Hodgkin disease tissue.

protein name :

Galectin-9

recommended detection systems :

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot.

last modified :

3/19/19 1:55