This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Boster
product type :
antibody
product name :
Anti-Cytokeratin 1/KRT1 Picoband Antibody
catalog :
PB9656
quantity :
100 ug/vial
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry
product information
sku :
PB9656
status :
Enabled
name :
Anti-Cytokeratin 1/KRT1 Picoband Antibody
category name :
Primary Antibodies, Polyclonal Antibodies, IHC ICC IF Antibodies
gene name :
Krt1
price various sizes :
Unconjugated / $280 APC / $330 APC-Cy7 / $330 FITC / $330 PE / $330 PE-Cy5 / $330 PE-Cy7 / $330 30ug sample size / $99 100ug / $280 100ug+Free HRP Secondary BA1054 / $280 100ug+Free Biotin Secondary BA1003 / $280
clonality :
Polyclonal
concentration :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
conjugate :
No
contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
description :
Polyclonal antibody for CYTOKERATIN 1/Krt1 detection. Host: Rabbit.Size: 100ug/vial. Tested applications: IHC-P. Reactive species: Human. CYTOKERATIN 1/Krt1 information: Molecular Weight: 65606 MW; Subcellular Localization: Cell membrane .
short description :
Rabbit IgG polyclonal antibody for Keratin, type II cytoskeletal 1(KRT1) detection. Tested with WB, IHC-P in Human;Mouse;Rat.
size :
100 ug/vial
sample size available :
30ug for $99, contact us for details
uniprot id :
P04104
host :
Rabbit
immunogen :
A synthetic peptide corresponding to a sequence at the N-terminus of mouse Cytokeratin 1 (223-257aa LQQVDTTTRTQNLDPFFENYISILRRKVDSLKSD Q), different from the related human sequence by ten amino acids, and from the related rat sequence by five amino acids.
form :
Lyophilized
purification :
Immunogen affinity purified.
storage :
At -20 C for one year. After reconstitution, at 4 C for one month. It can also be aliquotted and stored frozen at -20 C for a longer time.Avoid repeated freezing and thawing.
cross reactivity :
No cross reactivity with other proteins
reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
application details :
Immunohistochemistry(Paraffin-embedded Section), 0.5-1ug/ml, Human, Mouse, Rat, By Heat
. Western blot, 0.1-0.5ug/ml, Human, Mouse, Rat.
applications :
IHC, WB
reactivity :
Human, Mouse, Rat
image labels :
Anti- Cytokeratin 1 Picoband antibody, PB9656, Western blotting. All lanes: Anti Cytokeratin 1 (PB9656) at 0.5ug/ml.
Lane 1: Rat Liver Tissue Lysate at 50ug.
Lane 2: Rat Skeletal Muscle Tissue Lysate at 50ug.
Lane 3: Rat Spleen Tissue Lysate at 50ug.
Lane 4: SKOV Whole Cell Lysate at 40ug.
Lane 5: A431 Whole Cell Lysate at 40ug.
Predicted bind size: 67KD.
Observed bind size: 67KD Anti- Cytokeratin 1 Picoband antibody, PB9656, IHC(P). IHC(P): Rat Lung Tissue Anti- Cytokeratin 1 Picoband antibody, PB9656, IHC(P). IHC(P): Human Oesophagus Squama Cancer Tissue Anti- Cytokeratin 1 Picoband antibody, PB9656, IHC(P). IHC(P): Mouse Lung Tissue
background :
Keratin 1 (KRT1), also known as Cytokeratin 1, or Keratin, type II cytoskeletal 1, is a member of the keratin family. It is specifically expressed in the spinous and granular layers of the epidermis with family member keratin 10. Mutations in this gene have been associated with the variants ofbullous congenital ichthyosiform erythroderma in which the palms and soles of the feet are affected. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. And this type II cytokeratin is specifically expressed in the spinous and granular layers of the epidermis with family member KRT10 and mutations in these genes have been associated with bullous congenital ichthyosiform erythroderma. The type II cytokeratins are clustered in a region of chromosome 12q12-q13.
competitor equivalent skus :
sc 18260 sc 18259 sc 48802 sc 166092 sc 18258 sc 166091 sc 393594 sc 390096 sc 48802 X sc 166092 X sc 166091 X sc 166091 sc 166091 X sc 166092 sc 166092 X sc 18258 sc 18259 sc 18260 sc 390096 sc 393594 sc 48802 sc 48802 X
research category :
Class I, Cytoskeleton, Cytoskeleton / Ecm, Intermediate Filaments, Microtubules, Signal Transduction
synonyms :
Keratin, type II cytoskeletal 1;67 kDa cytokeratin;Cytokeratin-1;CK-1;Keratin-1;K1;Type-II keratin Kb1;Krt1;Krt2-1;
gene full name :
Keratin, type II cytoskeletal 1
molecular weight :
65606 MW
protein function :
May regulate the activity of kinases such as PKC and SRC via binding to integrin beta-1 (ITB1) and the receptor of activated protein C kinase 1 (RACK1). In complex with C1QBP is a high affinity receptor for kininogen-1/HMWK (By similarity).
subcellular localization :
cell membrane
protein name :
Keratin, type II cytoskeletal 1
recommended detection systems :
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).
last modified :
1/28/19 19:39
company information

Boster
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
https://www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
questions and comments