Anti-KChIP2/KCNIP2 Antibody Picoband™ | Boster PB9652 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-KChIP2/KCNIP2 Antibody Picoband™

catalog :

PB9652

quantity :

100μg/vial

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse

application :

western blot, immunocytochemistry, flow cytometry, immunohistochemistry - paraffin section

product information

SKU :

PB9652

Product Name :

Anti-KChIP2/KCNIP2 Antibody Picoband™

Size :

100μg/vial

Clonality :

Polyclonal

Host :

Rabbit

Reactivity :

Human, Mouse, Rat

Predicted Reactivity :

Chicken

Application(s) :

Flow Cytometry, IF, IHC-P, ICC, WB

Application Details :

Western blot, 0.1-0.5µg/ml, Human, Mouse, RatImmunohistochemistry (Paraffin-embedded Section), 0.5-1µg/ml, Human, Mouse, Rat, By Heat. Immunocytochemistry/Immunofluorescence, 2µg/ml, Human. Flow Cytometry, 1-3μg/1x10^6 cells, Human.

Application Notes :

Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

Description :

Boster Bio Anti-KChIP2/KCNIP2 Antibody Picoband™ catalog # PB9652. Tested in Flow Cytometry, IF, IHC-P, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.

Concentration :

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

Gene Name :

KCNIP2

Uniprot ID :

Q9NS61

Immunogen :

A synthetic peptide corresponding to a sequence at the N-terminus of human KChIP2 (78-112aa DEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYR), different from the related mouse and rat sequences by one amino acid.

Form :

Lyophilized

Contents :

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purification :

Immunogen affinity purified.

Cross-reactivity :

No cross reactivity with other proteins

Storage :

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Gene Full Name :

Kv channel-interacting protein 2

Synonyms :

Kv channel-interacting protein 2; KChIP2 ; A-type potassium channel modulatory protein 2; Cardiac voltage-gated potassium channel modulatory subunit; Potassium channel-interacting protein 2; KCNIP2; KCHIP2;

Protein Name :

Kv channel-interacting protein 2

Molecular Weight :

30907 MW

Protein Function :

Regulatory subunit of Kv4/D (Shal)-type voltage-gated rapidly inactivating A-type potassium channels. Modulates channel density, inactivation kinetics and rate of recovery from inactivation in a calcium-dependent and isoform-specific manner. In vitro, modulates KCND2/Kv4.2 and KCND3/Kv4.3 currents. Involved in KCND2 and KCND3 trafficking to the cell surface. May be required for the expression of I (To) currents in the heart (By similarity).

Subcellular Localization :

Isoform 1: Cell membrane ; Lipid-anchor. Detected on lipid rafts (By similarity).

Tissue Specificity :

Expressed in brain. Colocalizes with KCND2 in excitatory neurons including cortical and hippocampal CA1 pyramidal cells. Isoform 3 is expressed in heart and in umbilical vein endothelial cells. Not expressed in fetal heart.

Recommended Detection Systems :

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P) and ICC.

Background :

Kv channel-interacting protein 2 also known as KChIP2 is a protein that in humans is encoded by the KCNIP2 gene. This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins, which belong to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. And they are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. Alternative splicing results in multiple transcript variant encoding different isoforms.

Research Category :

Cardiovascular, Neuroscience, Neurotransmission, Potassium Channels, Receptors / Channels