This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Boster
product type :
antibody
product name :
Anti-Ikaros/IKZF1 Antibody Picoband™
catalog :
PB9643
quantity :
100μg/vial
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse
application :
western blot, immunocytochemistry, flow cytometry, immunohistochemistry - paraffin section
product information
SKU :
PB9643
Product Name :
Anti-Ikaros/IKZF1 Antibody Picoband™
Size :
100μg/vial
Clonality :
Polyclonal
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Application(s) :
Flow Cytometry, IF, IHC-P, ICC, WB
Application Details :
Western blot, 0.1-0.5µg/ml, Human.
Immunohistochemistry (Paraffin-embedded Section), 0.5-1µg/ml, Human, Mouse, Rat, By Heat.
Immunocytochemistry/Immunofluorescence, 5µg/ml, Human.
Flow Cytometry, 1-3μg/1x10^6 cells, Human.
Application Notes :
Tested Species: In-house tested species with positive results.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Description :
Boster Bio Anti-Ikaros/IKZF1 Antibody Picoband™ catalog # PB9643. Tested in Flow Cytometry, IF, IHC-P, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.
Concentration :
Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Gene Name :
IKZF1
Uniprot ID :
Q13422
Immunogen :
A synthetic peptide corresponding to a sequence at the C-terminus of human Ikaros (428-459aa LKEEHRAYDLLRAASENSQDALRVVSTSGEQM), different from the related mouse sequence by five amino acids.
Form :
Lyophilized
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Cross-reactivity :
No cross reactivity with other proteins
Storage :
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Gene Full Name :
DNA-binding protein Ikaros
Synonyms :
DNA-binding protein Ikaros; Ikaros family zinc finger protein 1; Lymphoid transcription factor LyF-1; IKZF1; IK1, IKAROS, LYF1, ZNFN1A1;
Protein Name :
DNA-binding protein Ikaros
Molecular Weight :
57528 MW
Protein Function :
Transcription regulator of hematopoietic cell differentiation (PubMed:17934067). Binds gamma-satellite DNA (PubMed:17135265, PubMed:19141594). Plays a role in the development of lymphocytes, B- and T-cells. Binds and activates the enhancer (delta-A element) of the CD3-delta gene. Repressor of the TDT (fikzfterminal deoxynucleotidyltransferase) gene during thymocyte differentiation. Regulates transcription through association with both HDAC-dependent and HDAC-independent complexes. Targets the 2 chromatin-remodeling complexes, NuRD and BAF (SWI/SNF), in a single complex (PYR complex), to the beta- globin locus in adult erythrocytes. Increases normal apoptosis in adult erythroid cells. Confers early temporal competence to retinal progenitor cells (RPCs) (By similarity). Function is isoform-specific and is modulated by dominant-negative inactive isoforms (PubMed:17135265, PubMed:17934067).
Subcellular Localization :
Nucleus. In resting lymphocytes, distributed diffusely throughout the nucleus. Localizes to pericentromeric heterochromatin in proliferating cells. This localization requires DNA binding which is regulated by phosphorylation / dephosphorylation events.
Tissue Specificity :
Abundantly expressed in thymus, spleen and peripheral blood Leukocytes and lymph nodes. Lower expression in bone marrow and small intestine.
Recommended Detection Systems :
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P) and ICC.
Background :
DNA-binding protein Ikaros is a protein that in humans is encoded by the IKZF1 gene. This gene encodes a transcription factor that belongs to the family of zinc-finger DNA-binding proteins associated with chromatin remodeling. The expression of this protein is restricted to the fetal and adult hemo-lymphopoietic system, and it functions as a regulator of lymphocyte differentiation. Several alternatively spliced transcript variants encoding different isoforms have been described for this gene. Most isoforms share a common C-terminal domain, which contains two zinc finger motifs that are required for hetero- or homo-dimerization, and for interactions with other proteins. The isoforms, however, differ in the number of N-terminal zinc finger motifs that bind DNA and in nuclear localization signal presence, resulting in members with and without DNA-binding properties. Only a few isoforms contain the requisite three or more N-terminal zinc motifs that confer high affinity binding to a specific core DNA sequence element in the promoters of target genes. The non-DNA-binding isoforms are largely found in the cytoplasm, and are thought to function as dominant-negative factors.
Research Category :
Apoptosis, Cancer, Cell Death, Domain Families, Epigenetics and Nuclear Signaling, Invasion/Microenvironment, Transcription, Zinc Finger
company information
Boster
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
https://www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
questions and comments