Anti-Grp75/HSPA9 Antibody Picoband™ | Boster PB9642 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-Grp75/HSPA9 Antibody Picoband™

catalog :

PB9642

quantity :

100μg/vial

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot, flow cytometry, immunohistochemistry - paraffin section

product information

SKU :

PB9642

Product Name :

Anti-Grp75/HSPA9 Antibody Picoband™

Size :

100μg/vial

Clonality :

Polyclonal

Host :

Rabbit

Reactivity :

Human, Monkey, Mouse

Application(s) :

Flow Cytometry, IHC-P, WB

Application Details :

Western blot, 0.1-0.5µg/ml, Human, Monkey, Mouse. Immunohistochemistry (Paraffin-embedded Section), 2-5µg/ml, Human, By Heat. Flow Cytometry, 1-3 μg/1x10^6 cells, Human.

Application Notes :

Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

Description :

Boster Bio Anti-Grp75/HSPA9 Antibody Picoband™ catalog # PB9642. Tested in Flow Cytometry, IHC-P, WB applications. This antibody reacts with Human, Monkey, Mouse.

Concentration :

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

Gene Name :

HSPA9

Uniprot ID :

P38646

Immunogen :

A synthetic peptide corresponding to a sequence at the C-terminus of human Grp75 (646-679aa KLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ), identical to the related mouse and rat sequences.

Form :

Lyophilized

Contents :

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purification :

Immunogen affinity purified.

Cross-reactivity :

No cross reactivity with other proteins

Storage :

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Gene Full Name :

Stress-70 protein, mitochondrial

Synonyms :

Stress-70 protein, mitochondrial; 75 kDa glucose-regulated protein; GRP-75; Heat shock 70 kDa protein 9; Mortalin; MOT; Peptide-binding protein 74; PBP74; HSPA9; GRP75, HSPA9B, mt-HSP70;

Protein Name :

Stress-70 protein, mitochondrial

Molecular Weight :

73680 MW

Protein Function :

Implicated in the control of cell proliferation and cellular aging. May also act as a chaperone.

Subcellular Localization :

Mitochondrion. Nucleus, nucleolus.

Recommended Detection Systems :

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).

Background :

HSPA9 (heat shock 70kDa protein 9 (mortalin)), also known as GRP75, mot-2, mthsp75, PBP74, HSPA9B, MORTALIN or MORTALIN, PERINUCLEAR, is a highly conserved member of the HSP70 family of proteins. It functions as a chaperone in the mitochondria, cytoplasm, and centrosome. The HSPA9 gene is mapped to chromosome 5q31.2 based on an alignment of the HSPA9 sequence with the genomic sequence. Knockdown of HSPA9 in erythroid cultures was associated with an increased number of cells in the G0/G1 phase of the cell cycle and accelerated apoptosis. Knockdown of Hspa9 in mouse bone marrow cells, followed by transplantation into wildtype recipients, also resulted in loss of erythroid cell number. Haploinsufficiency for HSPA9 may contribute to abnormal hematopoiesis in myelodysplastic syndromes. This protein plays a role in the control of cell proliferation.

Research Category :

Alzheimer'S Disease, Cancer, Cell Cycle, Cell Division, Chaperones, Heat Shock Proteins, Metabolism, Mitochondrial, Mitochondrial Markers, Mitochondrial Metabolism, Neurodegenerative Disease, Neurology Process, Neuroscience, Pathways And Processes, Protein Trafficking, Signal Transduction, Tumor Biomarkers