This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Boster
product type :
antibody
product name :
Anti-GRP78 BiP/HSPA5 Antibody Picoband™
catalog :
PB9640
quantity :
100μg/vial
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry
product information
SKU :
PB9640
Product Name :
Anti-GRP78 BiP/HSPA5 Antibody Picoband™
Size :
100μg/vial
Clonality :
Polyclonal
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Predicted Reactivity :
Hamster
Application(s) :
IHC, WB
Application Details :
Immunohistochemistry (Paraffin-embedded Section), 0.5-1µg/ml, Human, Mouse, Rat, By Heat. Western blot, 0.1-0.5µg/ml, Human.
Application Notes :
Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.
Description :
Boster Bio Anti-GRP78 BiP/HSPA5 Antibody Picoband™ catalog # PB9640. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat.
Concentration :
Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Gene Name :
HSPA5
Uniprot ID :
P11021
Immunogen :
A synthetic peptide corresponding to a sequence at the C-terminus of human GRP78 BiP (592-624aa ETMEKAVEEKIEWLESHQDADIEDFKAKKKELE), identical to the related mouse and rat sequences.
Form :
Lyophilized
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Cross-reactivity :
No cross reactivity with other proteins
Storage :
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Gene Full Name :
78 kDa glucose-regulated protein
Synonyms :
78 kDa glucose-regulated protein; GRP-78; Endoplasmic reticulum lumenal Ca (2+)-binding protein grp78; Heat shock 70 kDa protein 5; Immunoglobulin heavy chain-binding protein; BiP; HSPA5; GRP78;
Protein Name :
78 kDa glucose-regulated protein
Molecular Weight :
72333 MW
Protein Function :
Probably plays a role in facilitating the assembly of multimeric protein complexes inside the endoplasmic reticulum. Involved in the correct folding of proteins and degradation of misfolded proteins via its interaction with DNAJC10, probably to facilitate the release of DNAJC10 from its substrate.
Subcellular Localization :
Endoplasmic reticulum lumen. Melanosome. Cytoplasm. Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
Recommended Detection Systems :
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).
Background :
HSPA5 (heat shock 70kDa protein 5), also known as glucose-regulated protein, 78kD (GRP78) or BiP, is a member of the heat-shock protein-70 (HSP70) family and is involved in the folding and assembly of proteins in the endoplasmic reticulum. BiP is also an essential component of the translocation machinery, as well as playing a role in retrograde transport across the ER membrane of aberrant proteins destined for degradation by the proteasome. The HSPA5 gene is mapped on 9q33.3. Shen et al. (2002) concluded that HSPA5 retains ATF6 in the ER by inhibiting its Golgi localization signals and that dissociation of HSPA5 during ER stress allows ATF6 to be transported to the Golgi. The findings of Shen et al. (2002) demonstrated that HSPA5 is a key element in sensing the folding capacity within the ER.
Research Category :
Organelles, Subcellular Markers, Tags & Cell Markers
company information
Boster
3942 B Valley Ave
Pleasanton, CA 94566
boster@bosterbio.com
https://www.bosterbio.com
925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits