Anti-Hsp70/HSPA1A/HSPA1B Antibody Picoband™ | Boster PB9638 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-Hsp70/HSPA1A/HSPA1B Antibody Picoband™

catalog :

PB9638

quantity :

100μg/vial

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot, immunocytochemistry, flow cytometry, immunohistochemistry - paraffin section

product information

SKU :

PB9638

Product Name :

Anti-Hsp70/HSPA1A/HSPA1B Antibody Picoband™

Size :

100μg/vial

Clonality :

Polyclonal

Host :

Rabbit

Reactivity :

Human, Mouse, Rat

Predicted Reactivity :

Bovine, Horse, Monkey

Application(s) :

Flow Cytometry, IF, IHC-P, ICC, WB

Application Details :

Western blot, 0.1-0.5µg/ml, Human, Mouse, Rat. Immunohistochemistry (Paraffin-embedded Section), 0.5-1µg/ml, Human, Mouse, Rat, By Heat. Immunocytochemistry/Immunofluorescence, 5 µg/ml, Human. Flow Cytometry, 1-3 μg/1x10^6 cells, Human.

Application Notes :

Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

Description :

Boster Bio Anti-Hsp70/HSPA1A/HSPA1B Antibody Picoband™ catalog # PB9638. Tested in Flow Cytometry, IF, IHC-P, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.

Concentration :

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

Gene Name :

HSPA1A

Uniprot ID :

P0DMV8

Immunogen :

A synthetic peptide corresponding to a sequence at the C-terminus of human Hsp70 (559-596aa KGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKR), different from the related mouse sequence by five amino acids, and from the related rat sequence by three amino acids.

Form :

Lyophilized

Contents :

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purification :

Immunogen affinity purified.

Cross-reactivity :

No cross reactivity with other proteins

Storage :

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Gene Full Name :

Heat shock 70 kDa protein 1A

Synonyms :

Heat shock 70 kDa protein 1A ; Heat shock 70 kDa protein 1; HSP70-1 ; HSP70.1; HSPA1A; HSPA1, HSX70;

Protein Name :

Heat shock 70 kDa protein 1A/1B

Molecular Weight :

70052 MW

Protein Function :

In cooperation with other chaperones, Hsp70s stabilize preexistent proteins against aggregation and mediate the folding of newly translated polypeptides in the cytosol as well as within organelles. These chaperones participate in all these processes through their ability to recognize nonnative conformations of other proteins. They bind extended peptide segments with a net hydrophobic character exposed by polypeptides during translation and membrane translocation, or following stress-induced damage. In case of rotavirus A infection, serves as a post-attachment receptor for the virus to facilitate entry into the cell. Essential for STUB1-mediated ubiquitination and degradation of FOXP3 in regulatory T-cells (Treg) during inflammation (PubMed:23973223).

Subcellular Localization :

Cytoplasm. Localized in cytoplasmic mRNP granules containing untranslated mRNAs.

Recommended Detection Systems :

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P) and ICC.

Background :

HSPA1 (heat shock 70kDa protein 1A) also known as HSP70-1, HSPA1A, HSP70-1A, HSP72 or HSP70I, is a protein that in humans is encoded by the HSPA1A gene. This intronless gene encodes a 70kDa heat shock protein which is a member of the heat shock protein 70 family. The HSPA1A gene encodes a predicted 641-amino acid protein. The HSPA1 gene is mapped on 6p21.33. Shimizu et al. (1999) found that peripheral blood mononuclear cells of 18 major depression patients expressed a short HSPA1A transcript that utilized exon 1 rather than exon 2, which is found in the more common HSPA1A transcript. No protein was associated with expression of this short HSPA1A mRNA, possibly due to lack of a TATA box or loss of internal ribosome binding sites. Treatment with BGP-15, a pharmacologic inducer of Hsp72 that can protect against obesity-induced insulin resistance, improved muscular architecture, strength, and contractile function in severely affected diaphragm muscles in mdx dystrophic mice.

Research Category :

Cancer, Chaperones, Heat Shock Proteins, Protein Trafficking, Signal Transduction, Tumor Biomarkers