Anti-FMO3 Antibody Picoband™ | Boster PB9590 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-FMO3 Antibody Picoband™

catalog :

PB9590

quantity :

100μg/vial

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot

product information

SKU :

PB9590

Product Name :

Anti-FMO3 Antibody Picoband™

Size :

100μg/vial

Clonality :

Polyclonal

Host :

Rabbit

Reactivity :

Human, Mouse, Rat

Application(s) :

Application Details :

Western blot, 0.1-0.5µg/ml, Human, Mouse, Rat.

Application Notes :

Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Description :

Boster Bio Anti-FMO3 Antibody Picoband™ catalog # PB9590. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.

Concentration :

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

Gene Name :

FMO3

Uniprot ID :

P31513

Immunogen :

A synthetic peptide corresponding to a sequence at the C-terminus of human FMO3 (404-433aa DMMNDINEKMEKKRKWFGKSETIQTDYIVY), different from the related mouse sequence by eight amino acids, and from the related rat sequence by six amino acids.

Form :

Lyophilized

Contents :

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purification :

Immunogen affinity purified.

Cross-reactivity :

No cross reactivity with other proteins

Storage :

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Gene Full Name :

Dimethylaniline monooxygenase [N-oxide-forming] 3

Synonyms :

Dimethylaniline monooxygenase [N-oxide-forming] 3; 1.14.13.8; Dimethylaniline oxidase 3; FMO II; FMO form 2; Hepatic flavin-containing monooxygenase 3; FMO 3; Trimethylamine monooxygenase; 1.14.13.148; FMO3;

Protein Name :

Dimethylaniline monooxygenase [N-oxide-forming] 3

Molecular Weight :

60033 MW

Protein Function :

Involved in the oxidative metabolism of a variety of xenobiotics such as drugs and pesticides. It N-oxygenates primary aliphatic alkylamines as well as secondary and tertiary amines. Plays an important role in the metabolism of trimethylamine (TMA), via the production of TMA N-oxide (TMAO). Is also able to perform S-oxidation when acting on sulfide compounds (PubMed:9224773).

Subcellular Localization :

Microsome membrane. Endoplasmic reticulum membrane.

Tissue Specificity :

Liver

Recommended Detection Systems :

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot.

Sequence Similarities :

Belongs to the FMO family.

Background :

FMO3 (Flavin-containing Monooxygenase 3) is an enzyme that in humans is encoded by the FMO3 gene. The mammalian flavin-containing monooxygenases (FMO) represent a multigene family whose gene products are localized in the endoplasmic reticulum of many tissues. The FMO3 gene contains 1 noncoding and 8 coding exons. And the FMO3 gene is mapped on 1q24.3. Using quantitative RNase protection assays, FMO3 is present in low abundance in fetal liver and lung and in adult kidney and lung, and in much greater abundance in adult liver. By Western blot analysis of human liver microsomal samples ranging from 8 weeks gestation to 18 years of age, FMO1 is the major fetal isoform and FMO3 is the major adult isoform. FMO3 was expressed at intermediate levels until 11 years of age when a gender-independent increase in FMO3 expression was observed during puberty. Sufferers of trimethylaminuria may display a reduced ability to metabolize substrates for FMO3 such as nicotine. FMO3 metabolizes a number of drugs, including amphetamine, clozapine, deprenyl, metamphetamine, tamoxifen, ethionamide, thiacetazone, and sulindac sulfide.

Research Category :

Cancer, Drug Metabolism, Metabolic Signaling Pathways, Metabolism, Pathways And Processes, Signal Transduction