This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Boster
product type :
antibody
product name :
Anti-liver FABP/FABP1 Antibody Picoband™
catalog :
PB9586
quantity :
100μg/vial
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry
product information
SKU :
PB9586
Product Name :
Anti-liver FABP/FABP1 Antibody Picoband™
Size :
100μg/vial
Clonality :
Polyclonal
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Application(s) :
IHC, WB
Application Details :
Immunohistochemistry (Paraffin-embedded Section), 0.5-1µg/ml, Human, Mouse, Rat, By Heat.
Western blot, 0.1-0.5µg/ml, Human, Mouse, Rat.
Application Notes :
Tested Species: In-house tested species with positive results.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Description :
Boster Bio Anti-liver FABP/FABP1 Antibody Picoband™ catalog # PB9586. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat.
Concentration :
Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Gene Name :
FABP1
Uniprot ID :
P07148
Immunogen :
A synthetic peptide corresponding to a sequence at the N-terminus of human liver FABP (6-36aa KYQLQSQENFEAFMKAIGLPEELIQKGKDIK), different from the related mouse sequence by two amino acids, and from the related rat sequence by four amino acids.
Form :
Lyophilized
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Cross-reactivity :
No cross reactivity with other proteins
Storage :
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Gene Full Name :
Fatty acid-binding protein, liver
Synonyms :
Fatty acid-binding protein, liver; Fatty acid-binding protein 1; Liver-type fatty acid-binding protein; L-FABP; FABP1; FABPL;
Protein Name :
Fatty acid-binding protein, liver
Molecular Weight :
14208 MW
Protein Function :
Binds free fatty acids and their coenzyme A derivatives, bilirubin, and some other small molecules in the cytoplasm. May be involved in intracellular lipid transport.
Subcellular Localization :
Cytoplasm
Recommended Detection Systems :
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).
Background :
Fatty acid binding protein 1, liver, also known as FABP1 or FABPL, is a human gene locating at 2p11. FABP1 encodes the fatty acid binding protein found in liver. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind free fatty acids, their CoA derivatives, bilirubin, organic anions, and other small molecules. FABP1 and FABP6 (the ileal fatty acid binding protein) are also able to bind bile acids. It is thought that FABPs roles include fatty acid uptake, transport, and metaboism. The liver form of FABP may be identical to the major liver protein-1 (Lvp-1), which is encoded by a gene situated within 1 cM of Ly-2.
Research Category :
Lipid And Lipoprotein Metabolism, Lipid Metabolism, Metabolic Signaling Pathways, Metabolism, Pathways And Processes, Redox Metabolism, Signal Transduction
company information
Boster
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
https://www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
questions and comments