This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Boster
product type :
antibody
product name :
Anti-CD26/DPP4 Antibody Picoband™
catalog :
PB9580
quantity :
100μg/vial
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, rat
application :
western blot, immunocytochemistry
product information
SKU :
PB9580
Product Name :
Anti-CD26/DPP4 Antibody Picoband™
Size :
100μg/vial
Clonality :
Polyclonal
Host :
Rabbit
Reactivity :
Human, Rat
Application(s) :
IF, ICC, WB
Application Details :
Western blot, 0.1-0.5µg/ml, Human, Rat.
Immunocytochemistry/Immunofluorescence, 5 µg/ml, Human.
Application Notes :
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Description :
Boster Bio Anti-CD26/DPP4 Antibody Picoband™ catalog # PB9580. Tested in IF, ICC, WB applications. This antibody reacts with Human, Rat.
Concentration :
Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Gene Name :
DPP4
Uniprot ID :
P27487
Immunogen :
A synthetic peptide corresponding to a sequence at the C-terminus of human CD26 (731-761aa QAMWYTDEDHGIASSTAHQHIYTHMSHFIKQ), different from the related mouse and rat sequences by three amino acids.
Form :
Lyophilized
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Cross-reactivity :
No cross reactivity with other proteins
Storage :
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Gene Full Name :
Dipeptidyl peptidase 4
Synonyms :
Dipeptidyl peptidase 4; 3.4.14.5 ; ADABP; Adenosine deaminase complexing protein 2; ADCP-2; Dipeptidyl peptidase IV; DPP IV; T-cell activation antigen CD26; TP103; CD26; Dipeptidyl peptidase 4 membrane form; Dipeptidyl peptidase IV membrane form; Dipeptidyl peptidase 4 soluble form; Dipeptidyl peptidase IV soluble form; DPP4; ADCP2, CD26;
Protein Name :
Dipeptidyl peptidase 4
Molecular Weight :
88279 MW
Protein Function :
Cell surface glycoprotein receptor involved in the costimulatory signal essential for T-cell receptor (TCR)-mediated T-cell activation. Acts as a positive regulator of T-cell coactivation, by binding at least ADA, CAV1, IGF2R, and PTPRC. Its binding to CAV1 and CARD11 induces T-cell proliferation and NF- kappa-B activation in a T-cell receptor/CD3-dependent manner. Its interaction with ADA also regulates lymphocyte-epithelial cell adhesion. In association with FAP is involved in the pericellular proteolysis of the extracellular matrix (ECM), the migration and invasion of endothelial cells into the ECM. May be involved in the promotion of lymphatic endothelial cells adhesion, migration and tube formation. When overexpressed, enhanced cell proliferation, a process inhibited by GPC3. Acts also as a serine exopeptidase with a dipeptidyl peptidase activity that regulates various physiological processes by cleaving peptides in the circulation, including many chemokines, mitogenic growth factors, neuropeptides and peptide hormones. Removes N-terminal dipeptides sequentially from polypeptides having unsubstituted N-termini provided that the penultimate residue is proline.
Subcellular Localization :
Dipeptidyl peptidase 4 soluble form: Secreted. Detected in the serum and the seminal fluid.
Tissue Specificity :
Expressed specifically in lymphatic vessels but not in blood vessels in the skin, small intestine, esophagus, ovary, breast and prostate glands. Not detected in lymphatic vessels in the lung, kidney, uterus, liver and stomach (at protein level). Expressed in the poorly differentiated crypt cells of the small intestine as well as in the mature villous cells. Expressed at very low levels in the colon.
Recommended Detection Systems :
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for ICC.
Sequence Similarities :
Belongs to the peptidase S9B family. DPPIV subfamily.
Background :
Dipeptidyl peptidase-4 (DPP4), also known as CD26 (cluster of differentiation 26) is a protein that, in humans, is encoded by the DPP4 gene. The protein encoded by the DPP4 gene is an antigenic enzyme expressed on the surface of most cell types and is associated with immune regulation, signal transduction and apoptosis. Also, it is an intrinsic membrane glycoprotein and a serine exopeptidase that cleaves X-proline dipeptides from the N-terminus of polypeptides. DPP4 plays a major role in glucose metabolism. It is responsible for the degradation ofincretins such as GLP-1. Furthermore, it appears to work as a suppressor in the development of cancer andtumours.
company information
Boster
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
https://www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
questions and comments