Anti-AHSG Antibody Picoband™ | Boster PB9568 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-AHSG Antibody Picoband™

catalog :

PB9568

quantity :

100μg/vial

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, rat

application :

western blot, ELISA, immunohistochemistry, immunocytochemistry, flow cytometry

product information

SKU :

PB9568

Product Name :

Anti-AHSG Antibody Picoband™

Size :

100μg/vial

Clonality :

Polyclonal

Host :

Rabbit

Reactivity :

Human, Rat

Application(s) :

ELISA, Flow Cytometry, IHC, ICC, WB

Application Details :

Immunohistochemistry (Paraffin-embedded Section), 0.5-1µg/ml, Human, By Heat. ELISA, 0.1-0.5µg/ml, Human Western blot, 0.1-0.5µg/ml, Human, RatImmunohistochemistry (Frozen Section), 0.5-1µg/ml, Human. Immunocytochemistry, 0.5-1µg/ml, Human. Flow Cytometry, 1-3μg/1x10^6 cells, Human

Application Notes :

Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

Description :

Boster Bio Anti-AHSG Antibody Picoband™ catalog # PB9568. Tested in ELISA, Flow Cytometry, IHC, ICC, WB applications. This antibody reacts with Human, Rat.

Concentration :

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

Gene Name :

AHSG

Uniprot ID :

P02765

Immunogen :

A synthetic peptide corresponding to a sequence at the N-terminus of human Fetuin A (33-65aa DDPETEEAALVAIDYINQNLPWGYKHTLNQIDE), different from the related mouse and rat sequences by thirteen amino acids.

Form :

Lyophilized

Contents :

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purification :

Immunogen affinity purified.

Cross-reactivity :

No cross reactivity with other proteins

Storage :

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Gene Full Name :

Alpha-2-HS-glycoprotein

Synonyms :

Alpha-2-HS-glycoprotein; Alpha-2-Z-globulin; Ba-alpha-2-glycoprotein; Fetuin-A; Alpha-2-HS-glycoprotein chain A; Alpha-2-HS-glycoprotein chain B; AHSG; FETUA; PRO2743;

Protein Name :

Alpha-2-HS-glycoprotein

Molecular Weight :

39325 MW

Protein Function :

Promotes endocytosis, possesses opsonic properties and influences the mineral phase of bone. Shows affinity for calcium and barium ions.

Subcellular Localization :

Secreted.

Tissue Specificity :

Synthesized in liver and selectively concentrated in bone matrix. Secreted in plasma. It is also found in dentin in much higher quantities than other plasma proteins.

Recommended Detection Systems :

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P), IHC(F) and ICC.

Sequence Similarities :

Belongs to the fetuin family.

Background :

Alpha-2-HS-glycoprotein (AHSG), also known as fetuin-A, is a protein that in humans is encoded by the AHSG gene. Fetuin-A belongs to the fetuin class of plasma binding proteins and is more abundant in fetal than adult blood. Its gene is mapped to 3q27. The protein is commonly present in the cortical plate of the immature cerebral cortex and bone marrow hemopoietic matrix. It is involved in several functions, such as endocytosis, brain development and the formation of bone tissue.

Research Category :

Cardiovascular, Metabolism, Neurogenesis, Neurology Process, Neuroscience, Obesity, Serum Proteins