Anti-APRIL/TNFSF13 Picoband Antibody | Boster PB9523 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-APRIL/TNFSF13 Picoband Antibody

catalog :

PB9523

quantity :

100 ug/vial

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human

application :

western blot, ELISA

product information

sku :

PB9523

status :

Enabled

name :

Anti-APRIL/TNFSF13 Picoband Antibody

category name :

Primary Antibodies, Polyclonal Antibodies

gene name :

TNFSF13

price various sizes :

30ug sample size / $99 100ug / $240 100ug+Free HRP Secondary BA1054 / $240 100ug+Free Biotin Secondary BA1003 / $240

clonality :

Polyclonal

concentration :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

conjugate :

contents :

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

description :

Polyclonal antibody for APRIL/TNFSF13 detection. Host: Rabbit.Size: 100ug/vial. Tested applications: ELISA. Reactive species: Human. APRIL/TNFSF13 information: Molecular Weight: 27433 MW; Subcellular Localization: Secreted ; Tissue Specificity: Expressed at high levels in transformed cell lines, cancers of colon, thyroid, lymphoid tissues and specifically expressed in monocytes and macrophages.

short description :

Rabbit IgG polyclonal antibody for Tumor necrosis factor ligand superfamily member 13 (TNFSF13) detection. Tested with WB, ELISA in Human.

size :

100 ug/vial

sample size available :

30ug for $99, contact us for details

uniprot id :

O75888

host :

Rabbit

immunogen :

A synthetic peptide corresponding to a sequence in the middle region of human APRIL (122-151aa PINATSKDDSDVTEVMWQPALRRGRGLQAQ), different from the related mouse sequence by five amino acids.

form :

Lyophilized

purification :

Immunogen affinity purified.

storage :

At -20 C for one year. After reconstitution, at 4 C for one month. It can also be aliquotted and stored frozen at -20 C for a longer time.Avoid repeated freezing and thawing.

cross reactivity :

No cross reactivity with other proteins

reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

application details :

Western blot, 0.1-0.5ug/ml, Human, -. ELISA , 0.1-0.5ug/ml, Human.

applications :

ELISA, WB

reactivity :

Human

image labels :

Anti-APRIL Picoband antibody, PB9523, Western blotting. All lanes: Anti APRIL (PB9523) at 0.5ug/ml. Lane 1: HELA Whole Cell Lysate at 40ug. Lane 2: COLO320 Whole Cell Lysate at 40ug. Lane 3: SW620 Whole Cell Lysate at 40ug. Lane 4: JURKAT Whole Cell Lysate at 40ug. Lane 5: RAJI Whole Cell Lysate at 40ug. Lane 6: U937 Whole Cell Lysate at 40ug. Predicted bind size: 27KD. Observed bind size: 27KD

background :

A proliferation-inducing ligand (APRIL), also known as tumor necrosis factor ligand superfamily member 13 (TNFSF13), is a protein of the TNF superfamily recognized by the cell surface receptor TACI. The protein encoded by this gene is a member of the tumor necrosis factor (TNF) ligand family. And this protein is a ligand for TNFRSF17/BCMA, a member of the TNF receptor family. This protein and its receptor are both found to be important for B cell development. In vitro experiments suggested that this protein may be able to induce apoptosis through its interaction with other TNF receptor family proteins such as TNFRSF6/FAS and TNFRSF14/HVEM. Alternative splicing results in multiple transcript variants. Some transcripts that skip the last exon of the upstream gene (TNFSF12) and continue into the second exon of this gene have been identified; such read-through transcripts are contained in GeneID 407977, TNFSF12-TNFSF13.

competitor equivalent skus :

sc 12405 sc 28919 sc 374673 sc 374674 sc 57035 sc 5737 sc 5739

research category :

Adaptive Immunity, B Cells, Cancer, Cytokines, Growth Factors, Growth Factors/Hormones, Immunology, Innate Immunity, Non-Cd, Signal Transduction, Tnf Superfamily

synonyms :

Tumor necrosis factor ligand superfamily member 13;A proliferation-inducing ligand;APRIL;TNF- and APOL-related leukocyte expressed ligand 2;TALL-2;TNF-related death ligand 1;TRDL-1;CD256;TNFSF13;APRIL, TALL2, ZTNF2;UNQ383/PRO715;

gene full name :

Tumor necrosis factor ligand superfamily member 13

molecular weight :

27433 MW

protein function :

Cytokine that binds to TNFRSF13B/TACI and to TNFRSF17/BCMA. Plays a role in the regulation of tumor cell growth. May be involved in monocyte/macrophage-mediated immunological processes.

subcellular localization :

Secreted .

tissue specificity :

Expressed at high levels in transformed cell lines, cancers of colon, thyroid, lymphoid tissues and specifically expressed in monocytes and macrophages.

protein name :

Tumor necrosis factor ligand superfamily member 13

recommended detection systems :

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot.

last modified :

1/28/19 19:39