This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Boster
product type :
antibody
product name :
Anti-TMEM173 Antibody Picoband™
catalog :
PB9513
quantity :
100μg/vial
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot, immunohistochemistry
product information
SKU :
PB9513
Product Name :
Anti-TMEM173 Antibody Picoband™
Size :
100μg/vial
Clonality :
Polyclonal
Host :
Rabbit
Reactivity :
Human
Application(s) :
IHC, WB
Application Details :
Immunohistochemistry (Paraffin-embedded Section), 0.5-1µg/ml, Human, By Heat. Western blot, 0.1-0.5µg/ml, Human.
Application Notes :
Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.
Description :
Boster Bio Anti-TMEM173 Antibody Picoband™ catalog # PB9513. Tested in IHC, WB applications. This antibody reacts with Human.
Concentration :
Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Gene Name :
TMEM173
Uniprot ID :
Q86WV6
Immunogen :
A synthetic peptide corresponding to a sequence at the C-terminus of human TMEM173 (284-316aa RLEQAKLFCRTLEDILADAPESQNNCRLIAYQE), different from the related mouse sequence by five amino acids.
Form :
Lyophilized
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Cross-reactivity :
No cross reactivity with other proteins
Storage :
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Gene Full Name :
Stimulator of interferon genes protein
Synonyms :
Stimulator of interferon genes protein; hSTING; Endoplasmic reticulum interferon stimulator; ERIS; Mediator of IRF3 activation; hMITA; Transmembrane protein 173; TMEM173; ERIS, MITA, STING;
Protein Name :
Stimulator of interferon genes protein
Molecular Weight :
42193 MW
Protein Function :
Facilitator of innate immune signaling that acts as a sensor of cytosolic DNA from bacteria and viruses and promotes the production of type I interferon (IFN-alpha and IFN-beta). Innate immune response is triggered in response to non-CpG double- stranded DNA from viruses and bacteria delivered to the cytoplasm. Acts by recognizing and binding cyclic di-GMP (c-di-GMP), a second messenger produced by bacteria, and cyclic GMP-AMP (cGAMP), a messenger produced in response to DNA virus in the cytosol: upon binding of c-di-GMP or cGAMP, autoinhibition is alleviated and TMEM173/STING is able to activate both NF-kappa-B and IRF3 transcription pathways to induce expression of type I interferon and exert a potent anti-viral state. May be involved in translocon function, the translocon possibly being able to influence the induction of type I interferons. May be involved in transduction of apoptotic signals via its association with the major histocompatibility complex class II (MHC-II). Mediates death signaling via activation of the extracellular signal-regulated kinase (ERK) pathway. Essential for the induction of IFN-beta in response to human herpes simplex virus 1 (HHV-1) infection.
Subcellular Localization :
Endoplasmic reticulum membrane; Multi-pass membrane protein. Mitochondrion outer membrane; Multi-pass membrane protein. Cell membrane ; Multi-pass membrane protein. Cytoplasm, perinuclear region. Cytoplasm. In response to double-stranded DNA stimulation, relocalizes to perinuclear region, where the kinase TBK1 is recruited.
Tissue Specificity :
Ubiquitously expressed. Expressed in skin endothelial cells, alveolar type 2 pneumocytes, bronchial epithelium and alveolar macrophages.
Recommended Detection Systems :
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).
Background :
Transmembrane protein 173 is a protein that in humans is encoded by the TMEM173 gene. This gene encodes a five transmembrane protein that functions as a major regulator of the innate immune response to viral and bacterial infections. The encoded protein is a pattern recognition receptor that detects cytosolic nucleic acids and transmits signals that activate type I interferon responses. Also the encoded protein has been shown to play a role in apoptotic signaling by associating with type II major histocompatibility complex. Mutations in this gene are the cause of infantile-onset STING-associated vasculopathy. Alternate splicing results in multiple transcript variants.
Research Category :
Adapters, Antiviral Signaling, Cancer, Cytokines, Epigenetics and Nuclear Signaling, Immune System Diseases, Immunology, Innate Immunity, Interferons, Nfkb Pathway, Nuclear Signaling Pathways, Signal Transduction, Transmembrane
company information
Boster
3942 B Valley Ave
Pleasanton, CA 94566
boster@bosterbio.com
https://www.bosterbio.com
925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits