This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Boster
product type :
antibody
product name :
Anti-Scavenging Receptor SR-BI/SCARB1 Antibody Picoband™
catalog :
PB9502
quantity :
100μg/vial
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
mouse, rat
application :
western blot, immunohistochemistry, immunocytochemistry, flow cytometry
product information
SKU :
PB9502
Product Name :
Anti-Scavenging Receptor SR-BI/SCARB1 Antibody Picoband™
Size :
100μg/vial
Clonality :
Polyclonal
Host :
Rabbit
Reactivity :
Mouse, Rat
Predicted Reactivity :
Hamster
Application(s) :
Flow Cytometry, IHC, ICC, WB
Application Details :
Western blot, 0.1-0.5µg/ml, Mouse, RatImmunohistochemistry (Frozen Section), 0.5-1µg/ml, Mouse.
Immunocytochemistry, 0.5-1µg/ml, Mouse.
Flow Cytometry, 1-3μg/1x10^6 cells, Mouse
Application Notes :
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Description :
Boster Bio Anti-Scavenging Receptor SR-BI/SCARB1 Antibody Picoband™ catalog # PB9502. Tested in Flow Cytometry, IHC, ICC, WB applications. This antibody reacts with Mouse, Rat.
Concentration :
Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Gene Name :
Scarb1
Uniprot ID :
Q61009
Immunogen :
A synthetic peptide corresponding to a sequence at the C-terminus of mouse SCARB1 (478-509aa KKGSQDKEAIQAYSESLMSPAAKGTVLQEAKL), different from the related rat sequence by one amino acid.
Form :
Lyophilized
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Cross-reactivity :
No cross reactivity with other proteins
Storage :
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Gene Full Name :
Scavenger receptor class B member 1
Synonyms :
Scavenger receptor class B member 1; SRB1; SR-BI; Scarb1; Srb1;
Protein Name :
Scavenger receptor class B member 1
Molecular Weight :
56754 MW
Protein Function :
Receptor for different ligands such as phospholipids, cholesterol ester, lipoproteins, phosphatidylserine and apoptotic cells. Probable receptor for HDL, located in particular region of the plasma membrane, called caveolae. Facilitates the flux of free and esterified cholesterol between the cell surface and extracellular donors and acceptors, such as HDL and to a lesser extent, apoB-containing lipoproteins and modified lipoproteins. Probably involved in the phagocytosis of apoptotic cells, via its phosphatidylserine binding activity (By similarity). Plays an important role in the uptake of HDL cholesteryl ester (By similarity).
Subcellular Localization :
Cell membrane ; Multi-pass membrane protein. Membrane, caveola ; Multi-pass membrane protein. Predominantly localized to cholesterol and sphingomyelin-enriched domains within the plasma membrane, called caveolae.
Tissue Specificity :
Expressed primarily in liver and non-placental steroidogenic tissues.
Recommended Detection Systems :
Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB, supported by SA1022 in IHC(F) and ICC.
Background :
Scavenger receptor class B member 1 (SRB1), also known as SR-BI, is a protein that in humans is encoded by the SCARB1 gene. SR-BI functions as a receptor for high-density lipoprotein. Scavenger receptor class B, type I (SR-BI) is an integral membrane protein found in numerous cell types/tissues, including the liver and adrenal. It is best known for its role in facilitating the uptake of cholesteryl esters from high-density lipoproteins in the liver. This process drives the movement of cholesterol from peripheral tissues towards the liver for excretion. This movement of cholesterol is known as reverse cholesterol transport and is a protective mechanism against the development of atherosclerosis, which is the principal cause of heart disease and stroke. SR-BI has also been identified in the livers of non-mammalian species (turtle, goldfish, shark, chicken, frog, and skate), suggesting it emerged early in vertebrate evolutionary history. The turtle also seems to upregulate SB-RI during egg development, indicating that cholesterol efflux may be at peak levels during developmental stages.
Research Category :
Cancer, Cancer Metabolism, Cardiovascular, Cholesterol Metabolism, Host Virus Interaction, Interspecies Interaction, Lipid And Lipoprotein Metabolism, Lipid Metabolism, Lipids / Lipoproteins, Metabolic Signaling Pathway, Metabolic Signaling Pathways, Metabolism, Metabolism Of Lipids And Lipoproteins, Microbiology, Pathways And Processes, Signal Transduction
company information
Boster
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
https://www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
questions and comments