Anti-ATX2/ATXN2 Antibody Picoband™ | Boster PB9483 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-ATX2/ATXN2 Antibody Picoband™

catalog :

PB9483

quantity :

100μg/vial

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry - paraffin section

product information

SKU :

PB9483

Product Name :

Anti-ATX2/ATXN2 Antibody Picoband™

Size :

100μg/vial

Clonality :

Polyclonal

Host :

Rabbit

Reactivity :

Human, Mouse, Rat

Predicted Reactivity :

Hamster

Application(s) :

IHC-P, WB

Application Details :

Western blot, 0.1-0.5µg/ml, Human, Mouse, Rat. Immunohistochemistry (Paraffin-embedded Section), 2-5µg/ml, Human, By Heat.

Application Notes :

Tested Species: In-house tested species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

Description :

Boster Bio Anti-ATX2/ATXN2 Antibody Picoband™ catalog # PB9483. Tested in IHC-P, WB applications. This antibody reacts with Human, Mouse, Rat.

Concentration :

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

Gene Name :

ATXN2

Uniprot ID :

Q99700

Immunogen :

A synthetic peptide corresponding to a sequence at the C-terminus of human ATX2 (1283-1313aa QSALQPIPVSTTAHFPYMTHPSVQAHHQQQL), identical to the related mouse sequence.

Form :

Lyophilized

Contents :

Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.

Purification :

Immunogen affinity purified.

Cross-reactivity :

No cross reactivity with other proteins

Storage :

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Gene Full Name :

Ataxin-2

Synonyms :

Ataxin-2; Spinocerebellar ataxia type 2 protein; Trinucleotide repeat-containing gene 13 protein; ATXN2; ATX2, SCA2, TNRC13;

Protein Name :

Ataxin-2

Molecular Weight :

140283 MW

Protein Function :

Involved in EGFR trafficking, acting as negative regulator of endocytic EGFR internalization at the plasma membrane.

Subcellular Localization :

Cytoplasm

Tissue Specificity :

Expressed in the brain, heart, liver, skeletal muscle, pancreas and placenta. Isoform 1 is predominant in the brain and spinal cord. Isoform 4 is more abundant in the cerebellum. In the brain, broadly expressed in the amygdala, caudate nucleus, corpus callosum, hippocampus, hypothalamus, substantia nigra, subthalamic nucleus and thalamus.

Recommended Detection Systems :

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).

Background :

Ataxin-2, the protein encoded by the ATXN2 gene, contains a polyglutamine tract, long expansions (greater than 33 repeats) of which result in spinocerebellar ataxia-2 (SCA2), an autosomal dominant form of olivopontocerebellar atrophy. The gene for spinocerebellar ataxia type 2 (SCA2) has been mapped to 12q24.1. Ataxin-2 associates with L- and T-plastin and that overexpression of ataxin-2 leads to accumulation of T-plastin in mammalian cells.

Research Category :

Cell Biology, DNA / RNA, Epigenetics and Nuclear Signaling, Neurodegenerative Disease, Neurology Process, Neuroscience, Translation