This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Boster
product type :
antibody
product name :
Anti-Aquaporin 1/AQP1 Antibody Picoband™
catalog :
PB9473
quantity :
100μg/vial
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunocytochemistry, flow cytometry, immunohistochemistry - paraffin section
product information
SKU :
PB9473
Product Name :
Anti-Aquaporin 1/AQP1 Antibody Picoband™
Size :
100μg/vial
Clonality :
Polyclonal
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Predicted Reactivity :
Bovine
Application(s) :
Flow Cytometry, IF, IHC-P, ICC, WB
Application Details :
Western blot, 0.1-0.5µg/ml, Mouse, Rat.
Immunohistochemistry (Paraffin-embedded Section), 0.5-1µg/ml, Human, Mouse, Rat, By Heat.
Immunocytochemistry/Immunofluorescence, 2µg/ml, Rat.
Flow Cytometry, 1-3μg/1x10^6 cells, Human
Application Notes :
Tested Species: In-house tested species with positive results.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Description :
Boster Bio Anti-Aquaporin 1/AQP1 Antibody Picoband™ catalog # PB9473. Tested in Flow Cytometry, IF, IHC-P, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.
Concentration :
Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Gene Name :
AQP1
Uniprot ID :
P29972
Immunogen :
A synthetic peptide corresponding to a sequence at the C-terminus of human Aquaporin 1 (240-269aa DRVKVWTSGQVEEYDLDADDINSRVEMKPK), different from the related mouse and rat sequences by one amino acid.
Form :
Lyophilized
Contents :
Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.
Purification :
Immunogen affinity purified.
Cross-reactivity :
No cross reactivity with other proteins
Storage :
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Gene Full Name :
Aquaporin-1
Synonyms :
Aquaporin-1; AQP-1; Aquaporin-CHIP; Urine water channel; Water channel protein for red blood cells and kidney proximal tubule; AQP1; CHIP28;
Protein Name :
Aquaporin-1
Molecular Weight :
28526 MW
Protein Function :
Forms a water-specific channel that provides the plasma membranes of red cells and kidney proximal tubules with high permeability to water, thereby permitting water to move in the direction of an osmotic gradient.
Subcellular Localization :
Cell membrane ; Multi-pass membrane protein.
Tissue Specificity :
Detected in erythrocytes (at protein level). Expressed in a number of tissues including erythrocytes, renal tubules, retinal pigment epithelium, heart, lung, skeletal muscle, kidney and pancreas. Weakly expressed in brain, placenta and liver.
Recommended Detection Systems :
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P) and ICC.
Sequence Similarities :
Belongs to the MIP/aquaporin (TC 1.A.8) family.
Background :
Aquaporin 1 is a 28-kD integral protein thought at first to be a breakdown product of the Rh polypeptide but was later shown to be a unique molecule that is abundant in erythrocytes and renal tubules. AQP1 is also expressed by the choroid plexus and various other tissues. It forms a water-specific channel that provides the plasma membranes of red cells and kidney proximal tubules with high permeability to water, thereby permitting water to move in the direction of an osmotic gradient.
Research Category :
Channels, Metabolism, Plasma Membrane, Signal Transduction, Vitamins / Minerals
company information
Boster
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
https://www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
questions and comments