Anti-RAGE/AGER Antibody Picoband™ | Boster PB9469 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-RAGE/AGER Antibody Picoband™

catalog :

PB9469

quantity :

100μg/vial

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry

product information

SKU :

PB9469

Product Name :

Anti-RAGE/AGER Antibody Picoband™

Size :

100μg/vial

Clonality :

Polyclonal

Host :

Rabbit

Reactivity :

Human, Mouse, Rat

Application(s) :

IHC, WB

Application Details :

Immunohistochemistry (Paraffin-embedded Section), 0.5-1µg/ml, Human, Mouse, Rat, By Heat. Western blot, 0.1-0.5µg/ml, Human, Rat.

Application Notes :

Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

Description :

Boster Bio Anti-RAGE/AGER Antibody Picoband™ catalog # PB9469. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat.

Concentration :

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

Gene Name :

AGER

Uniprot ID :

Q15109

Immunogen :

A synthetic peptide corresponding to a sequence at the N-terminus of human RAGE (91-120aa IQDEGIFRCQAMNRNGKETKSNYRVRVYQI), different from the related mouse and rat sequences by six amino acids.

Form :

Lyophilized

Contents :

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purification :

Immunogen affinity purified.

Cross-reactivity :

No cross reactivity with other proteins

Storage :

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Gene Full Name :

Advanced glycosylation end product-specific receptor

Synonyms :

Advanced glycosylation end product-specific receptor; Receptor for advanced glycosylation end products; AGER; RAGE;

Protein Name :

Advanced glycosylation end product-specific receptor

Molecular Weight :

42803 MW

Protein Function :

Mediates interactions of advanced glycosylation end products (AGE). These are nonenzymatically glycosylated proteins which accumulate in vascular tissue in aging and at an accelerated rate in diabetes. Acts as a mediator of both acute and chronic vascular inflammation in conditions such as atherosclerosis and in particular as a complication of diabetes. AGE/RAGE signaling plays an important role in regulating the production/expression of TNF- alpha, oxidative stress, and endothelial dysfunction in type 2 diabetes. Interaction with S100A12 on endothelium, mononuclear phagocytes, and lymphocytes triggers cellular activation, with generation of key proinflammatory mediators. Interaction with S100B after myocardial infarction may play a role in myocyte apoptosis by activating ERK1/2 and p53/TP53 signaling (By similarity). Receptor for amyloid beta peptide. Contributes to the translocation of amyloid-beta peptide (ABPP) across the cell membrane from the extracellular to the intracellular space in cortical neurons. ABPP-initiated RAGE signaling, especially stimulation of p38 mitogen-activated protein kinase (MAPK), has the capacity to drive a transport system delivering ABPP as a complex with RAGE to the intraneuronal space. Can also bind oligonucleotides.

Subcellular Localization :

Isoform 1: Cell membrane; Single-pass type I membrane protein.

Tissue Specificity :

Endothelial cells

Recommended Detection Systems :

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).

Sequence Similarities :

Contains 2 Ig-like C2-type (immunoglobulin-like) domains.

Background :

The receptor for advanced glycation end products (RAGE) is a multi-ligand member of the immunoglobulin superfamily of cell surface molecules. It interacts with distinct molecules implicated in homeostasis, development and inflammation, and certain diseases such as diabetes and Alzheimer's disease. RAGE is also a central cell surface receptor for amphoterin and EN-RAGE. And RAGE is associated with sustained NF-kappaB activation in the diabetic microenvironment and has a central role in sensory neuronal dysfunction. Moreover, RAGE propagates cellular dysfunction in several inflammatory disorders and diabetes, and it also functions as an endothelial adhesion receptor promoting leukocyte recruitment.

Research Category :

Alzheimer'S Disease, Atherosclerosis, Cardiovascular, Diabetes Associated, Neurodegenerative Disease, Neurology Process, Neuroscience, Sensory System, Vascular Inflammation, Visual System