This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Boster
product type :
antibody
product name :
Anti-Tyrosine Hydroxylase/TH Antibody Picoband™
catalog :
PB9449
quantity :
100μg/vial
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, immunocytochemistry
product information
SKU :
PB9449
Product Name :
Anti-Tyrosine Hydroxylase/TH Antibody Picoband™
Size :
100μg/vial
Clonality :
Polyclonal
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Predicted Reactivity :
Hamster
Application(s) :
IF, IHC, ICC, WB
Application Details :
Immunohistochemistry (Paraffin-embedded Section), 0.5-1µg/ml, Mouse, Rat, Human, By Heat. Immunocytochemistry/Immunofluorescence, 5µg/ml, Human Western blot, 0.1-0.5µg/ml, Mouse, Rat, Human .
Application Notes :
WB: The detection limit for Tyrosine Hydroxylase is approximately 0.1ng/lane under reducing conditions.
Predicted Species: Species predicted to be fit for the product based on sequence similarities.
Tested Species: In-house tested species with positive results.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Description :
Boster Bio Anti-Tyrosine Hydroxylase/TH Antibody Picoband™ catalog # PB9449. Tested in IF, IHC, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.
Concentration :
Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Gene Name :
TH
Uniprot ID :
P07101
Immunogen :
A synthetic peptide corresponding to a sequence in the middle region of human Tyrosine Hydroxylase (193-222aa KVPWFPRKVSELDKCHHLVTKFDPDLDLDH), identical to the related mouse and rat sequences.
Form :
Lyophilized
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Cross-reactivity :
No cross reactivity with other proteins
Storage :
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Gene Full Name :
Tyrosine 3-monooxygenase
Synonyms :
Tyrosine 3-monooxygenase; 1.14.16.2; Tyrosine 3-hydroxylase; TH; TH; TYH;
Protein Name :
Tyrosine 3-monooxygenase
Molecular Weight :
58600 MW
Protein Function :
Plays an important role in the physiology of adrenergic neurons.
Tissue Specificity :
Mainly expressed in the brain and adrenal glands.
Recommended Detection Systems :
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P) and ICC.
Sequence Similarities :
Belongs to the biopterin-dependent aromatic amino acid hydroxylase family.
Background :
TH is equal to tyrosine hydroxylase. The protein encoded by this gene is involved in the conversion of tyrosine to dopamine. It is the rate-limiting enzyme in the synthesis of catecholamines, hence plays a key role in the physiology of adrenergic neurons. Mutations in this gene have been associated with autosomal recessive Segawa syndrome. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene. In humans, tyrosine hydroxylase is encoded by the TH gene, and the enzyme is present in the central nervous system (CNS), peripheral sympathetic neurons and the adrenal medulla. Tyrosine hydroxylase, phenylalanine hydroxylase and tryptophan hydroxylase together make up the family of aromatic amino acid hydroxylases (AAAHs).
Research Category :
Cancer, Cancer Metabolism, Cell Type Marker, Endocrine Metabolism, Hormone Biosynthesis, Hypoxia, Metabolic Signaling Pathway, Metabolism, Metabolism Processes, Neuron Marker, Neuroscience, Neurotransmitter, Pathways And Processes, Response To Hypoxia
company information
Boster
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
https://www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
questions and comments
