This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Boster
product type :
antibody
product name :
Anti-SLUG/SNAI2 Picoband Antibody
catalog :
PB9439
quantity :
100 ug/vial
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry
product information
sku :
PB9439
status :
Enabled
name :
Anti-SLUG/SNAI2 Picoband Antibody
category name :
Primary Antibodies, Polyclonal Antibodies, IHC ICC IF Antibodies
gene name :
SNAI2
price various sizes :
Unconjugated / $280 APC / $330 APC-Cy7 / $330 FITC / $330 PE / $330 PE-Cy5 / $330 PE-Cy7 / $330 30ug sample size / $99 100ug / $280 100ug+Free HRP Secondary BA1054 / $280 100ug+Free Biotin Secondary BA1003 / $280
clonality :
Polyclonal
concentration :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
conjugate :
No
contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
description :
Polyclonal antibody for Slug/SNAI2 detection. Host: Rabbit.Size: 100ug/vial. Tested applications: IHC-P. Reactive species: Human. Slug/SNAI2 information: Molecular Weight: 29986 MW; Subcellular Localization: Nucleus. Cytoplasm. Observed in discrete foci in interphase nuclei. These nuclear foci do not overlap with the nucleoli, the SP100 and the HP1 heterochromatin or the coiled body, suggesting SNAI2 is associated with active transcription or active splicing regions; Tissue Specificity: Expressed in most adult human tissues, including spleen, thymus, prostate, testis, ovary, small intestine, colon, heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Not detected in peripheral blood leukocyte. Expressed in the dermis and in all layers of the epidermis, with high levels of expression in the basal layers (at protein level). Expressed in osteoblasts (at protein level). Expressed in mesenchymal stem cells (at protein level). Expressed in breast tumor cells (at protein level).
short description :
Rabbit IgG polyclonal antibody for Zinc finger protein SNAI2(SNAI2) detection. Tested with WB, IHC-P in Human;Mouse;Rat.
size :
100 ug/vial
sample size available :
30ug for $99, contact us for details
uniprot id :
O43623
host :
Rabbit
immunogen :
A synthetic peptide corresponding to a sequence in the middle region of human SLUG (116-148aa KLSDPHAIEAEKFQCNLCNKTYSTFSGLAKHKQ), identical to the related mouse and rat sequences.
form :
Lyophilized
purification :
Immunogen affinity purified.
storage :
At -20 C for one year. After reconstitution, at 4 C for one month. It can also be aliquotted and stored frozen at -20 C for a longer time.Avoid repeated freezing and thawing.
cross reactivity :
No cross reactivity with other proteins
reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
application details :
Immunohistochemistry(Paraffin-embedded Section), 0.5-1ug/ml, Mouse, Rat, Human, By Heat. Western blot, 0.1-0.5ug/ml, Human, Mouse.
applications :
IHC, WB
reactivity :
Human, Mouse, Rat
predicted reactivity :
Hamster
image labels :
Anti- SLUG Picoband antibody, PB9439, Western blotting. All lanes: Anti SLUG (PB9439) at 0.5ug/ml. Lane 1: Mosue Kidney Tissue Lysate at 50ug. Lane 2: Mouse Lung Tissue Lysate at 50ug. Lane 3: Mouse Spleen Tissue Lysate at 50ug. Lane 4: Mouse Brain Tissue Lysate at 50ug. Lane 5: MCF-7 Whole Cell Lysate at 40ug. Predicted bind size: 30KD. Observed bind size: 39KD Anti- SLUG Picoband antibody, PB9439,IHC(P). IHC(P): Mouse Cardiac Muscle Tissue Anti- SLUG Picoband antibody, PB9439,IHC(P). IHC(P): Rat Cardiac Muscle Tissue
background :
SLUG is also known as SNAI2. This gene encodes a member of the Snail family of C2H2-type zinc finger transcription factors. The encoded protein acts as a transcriptional repressor that binds to E-box motifs and is also likely to repress E-cadherin transcription in breast carcinoma. This protein is involved in epithelial-mesenchymal transitions and has antiapoptotic activity. Mutations in this gene may be associated with sporatic cases of neural tube defects.
competitor equivalent skus :
sc 10436 sc 10436 X sc 10437 sc 10437 X sc 15391 sc 15391 X sc 166476 sc 166476 X sc 166902 sc 166902 X
research category :
Cancer, Cell Type Marker, Developmental Biology, Domain Families, Epigenetics And Nuclear Signaling, Lineage Markers, Lineage Specification, Nervous System Development, Neural Stem Cells, Neurogenesis, Neurology Process, Neuroscience, Oncoproteins, Oncoproteins/Suppressors, Organogenesis, Stem Cells, Transcription, Transcription Factors, Zinc Finger
synonyms :
Zinc finger protein SNAI2;Neural crest transcription factor Slug;Protein snail homolog 2;SNAI2;SLUG, SLUGH;
gene full name :
Zinc finger protein SNAI2
molecular weight :
29986 MW
protein function :
Transcriptional repressor that modulates both activator- dependent and basal transcription. Involved in the generation and migration of neural crest cells. Plays a role in mediating RAF1- induced transcriptional repression of the TJ protein, occludin (OCLN) and subsequent oncogenic transformation of epithelial cells (By similarity). Represses BRCA2 expression by binding to its E2- box-containing silencer and recruiting CTBP1 and HDAC1 in breast cells. In epidermal keratinocytes, binds to the E-box in ITGA3 promoter and represses its transcription. Involved in the regulation of ITGB1 and ITGB4 expression and cell adhesion and proliferation in epidermal keratinocytes. Binds to E-box2 domain of BSG and activates its expression during TGFB1-induced epithelial-mesenchymal transition (EMT) in hepatocytes. Represses E-Cadherin/CDH1 transcription via E-box elements. Involved in osteoblast maturation. Binds to RUNX2 and SOC9 promoters and may act as a positive and negative transcription regulator, respectively, in osteoblasts. Binds to CXCL12 promoter via E-box regions in mesenchymal stem cells and osteoblasts. Plays an essential role in TWIST1-induced EMT and its ability to promote invasion and metastasis.
subcellular localization :
Nucleus. Cytoplasm. Observed in discrete foci in interphase nuclei. These nuclear foci do not overlap with the nucleoli, the SP100 and the HP1 heterochromatin or the coiled body, suggesting SNAI2 is associated with active transcription or active splicing regions.
tissue specificity :
Expressed in most adult human tissues, including spleen, thymus, prostate, testis, ovary, small intestine, colon, heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Not detected in peripheral blood leukocyte. Expressed in the dermis and in all layers of the epidermis, with high levels of expression in the basal layers (at protein level). Expressed in osteoblasts (at protein level). Expressed in mesenchymal stem cells (at protein level). Expressed in breast tumor cells (at protein level).
protein name :
Zinc finger protein SNAI2
recommended detection systems :
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).
sequence similarities :
Belongs to the snail C2H2-type zinc-finger protein family.
last modified :
1/28/19 19:39
company information

Boster
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
https://www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
questions and comments