This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Boster
product type :
antibody
product name :
Anti-STAT6 Antibody Picoband™
catalog :
PB9405
quantity :
100μg/vial
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, rat
application :
western blot
product information
SKU :
PB9405
Product Name :
Anti-STAT6 Antibody Picoband™
Size :
100μg/vial
Clonality :
Polyclonal
Host :
Rabbit
Reactivity :
Human, Rat
Application(s) :
WB
Application Details :
Western blot, 0.1-0.5µg/ml, Rat, Human .
Application Notes :
WB: The detection limit for STAT6 is approximately 0.1ng/lane under reducing conditions. Tested Species: In-house tested species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users.
Description :
Boster Bio Anti-STAT6 Antibody Picoband™ catalog # PB9405. Tested in WB applications. This antibody reacts with Human, Rat.
Concentration :
Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Gene Name :
STAT6
Uniprot ID :
P42226
Immunogen :
A synthetic peptide corresponding to a sequence at the N-terminus of human STAT6 (85-115aa ESIYQRDPLKLVATFRQILQGEKKAVMEQFR), different from the related mouse sequence by three amino acids.
Form :
Lyophilized
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Cross-reactivity :
No cross reactivity with other proteins.
Storage :
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Gene Full Name :
Signal transducer and activator of transcription 6
Synonyms :
Signal transducer and activator of transcription 6; IL-4 Stat; STAT6;
Protein Name :
Signal transducer and activator of transcription 6
Molecular Weight :
94135 MW
Protein Function :
Carries out a dual function: signal transduction and activation of transcription. Involved in IL4/interleukin-4- and IL3/interleukin-3-mediated signaling.
Subcellular Localization :
Cytoplasm. Nucleus. Translocated into the nucleus in response to phosphorylation.
Recommended Detection Systems :
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot.
Sequence Similarities :
Belongs to the transcription factor STAT family.
Background :
STAT6 is a human gene. The protein encoded by this gene is a member of the STAT family of transcription factors. The gene spans 19 kb and contains 23 exons. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein plays a central role in exerting IL4 mediated biological responses. It is found to induce the expression of BCL2L1/BCL-X (L), which is responsible for the anti-apoptotic activity of IL4. Knockout studies in mice suggested the roles of this gene in differentiation of T helper 2 (Th2), expression of cell surface markers, and class switch of immunoglobulins.
Research Category :
Cancer, Epigenetics and Nuclear Signaling, Nuclear Signaling, Nuclear Signaling Pathways, Signal Transduction, Signaling Pathway, Transcription, Transcription Factors
company information
Boster
3942 B Valley Ave
Pleasanton, CA 94566
boster@bosterbio.com
https://www.bosterbio.com
925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits