Anti-Neuropeptide Y/NPY Antibody Picoband™ | Boster PB9296 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-Neuropeptide Y/NPY Antibody Picoband™

catalog :

PB9296

quantity :

100μg/vial

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry

product information

SKU :

PB9296

Product Name :

Anti-Neuropeptide Y/NPY Antibody Picoband™

Size :

100μg/vial

Clonality :

Polyclonal

Host :

Rabbit

Reactivity :

Human, Mouse, Rat

Predicted Reactivity :

Chicken

Application(s) :

IHC, WB

Application Details :

Immunohistochemistry (Paraffin-embedded Section), 0.5-1µg/ml, Mouse, Rat, Human, By Heat. Western blot, 0.1-0.5µg/ml, Human.

Application Notes :

WB: The detection limit for Neuropeptide Y is approximately 0.1ng/lane under reducing conditions. Tested Species: In-house tested species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

Description :

Boster Bio Anti-Neuropeptide Y/NPY Antibody Picoband™ catalog # PB9296. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat.

Concentration :

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

Gene Name :

NPY

Uniprot ID :

P01303

Immunogen :

A synthetic peptide corresponding to a sequence in the middle region of human Neuropeptide Y (29-64aa YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY), identical to the related mouse and rat sequences.

Form :

Lyophilized

Contents :

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purification :

Immunogen affinity purified.

Cross-reactivity :

No cross reactivity with other proteins

Storage :

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Gene Full Name :

Pro-neuropeptide Y

Synonyms :

Pro-neuropeptide Y; Neuropeptide Y; Neuropeptide tyrosine; NPY; C-flanking peptide of NPY; CPON; NPY;

Protein Name :

Pro-neuropeptide Y

Molecular Weight :

10851 MW

Protein Function :

NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone.

Subcellular Localization :

Secreted.

Tissue Specificity :

One of the most abundant peptides in the nervous system. Also found in some chromaffin cells of the adrenal medulla.

Recommended Detection Systems :

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).

Sequence Similarities :

Belongs to the NPY family.

Background :

This gene encodes a neuropeptide that is widely expressed in the central nervous system and influences many physiological processes, including cortical excitability, stress response, food intake, circadian rhythms, and cardiovascular function. The neuropeptide functions through G protein-coupled receptors to inhibit adenylyl cyclase, activate mitogen-activated protein kinase (MAPK), regulate intracellular calcium levels, and activate potassium channels. A polymorphism in this gene resulting in a change of leucine 7 to proline in the signal peptide is associated with elevated cholesterol levels, higher alcohol consumption, and may be a risk factor for various metabolic and cardiovascular diseases. The protein also exhibits antimicrobial activity against bacteria and fungi.

Research Category :

Biochemicals, Chemical Type, Neuropeptides, Neuroscience, Neurotransmitter, Obesity