This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Boster
product type :
antibody
product name :
Anti-MMP3 Antibody Picoband™
catalog :
PB9267
quantity :
100μg/vial
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot
product information
SKU :
PB9267
Product Name :
Anti-MMP3 Antibody Picoband™
Size :
100μg/vial
Clonality :
Polyclonal
Host :
Rabbit
Reactivity :
Human
Application(s) :
WB
Application Details :
Western blot, 0.1-0.5µg/ml, Human.
Application Notes :
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Description :
Boster Bio Anti-MMP3 Antibody Picoband™ catalog # PB9267. Tested in WB applications. This antibody reacts with Human.
Concentration :
Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Gene Name :
MMP3
Uniprot ID :
P08254
Immunogen :
A synthetic peptide corresponding to a sequence at the C-terminal of human MMP3 (410-439aa RFDEKRNSMEPGFPKQIAEDFPGIDSKIDA), different from the related mouse sequence by seven amino acids, and from the related mouse sequence by ten amino acids.
Form :
Lyophilized
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Cross-reactivity :
No cross-reactivity with other proteins
Storage :
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Gene Full Name :
Stromelysin-1
Synonyms :
Stromelysin-1; SL-1; 3.4.24.17; Matrix metalloproteinase-3; MMP-3; Transin-1; MMP3; STMY1;
Protein Name :
Stromelysin-1
Molecular Weight :
53977 MW
Protein Function :
Can degrade fibronectin, laminin, gelatins of type I, III, IV, and V; collagens III, IV, X, and IX, and cartilage proteoglycans. Activates procollagenase.
Subcellular Localization :
Secreted, extracellular space, extracellular matrix.
Recommended Detection Systems :
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot.
Sequence Similarities :
Belongs to the peptidase M10A family.
Background :
Stromelysin-1, also known as matrix metalloproteinase-3 (MMP-3), is an enzyme that in humans is encoded by the MMP3 gene. It is mapped to 11q22.2. Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix and during tissue remodeling in normal physiological processes, such as embryonic development and reproduction, as well as in disease processes, such as arthritis, and tumour metastasis. The MMP-3 enzyme degrades collagen types II, III, IV, IX, and X, proteoglycans, fibronectin, laminin, and elastin. In addition, MMP-3 can also activate other MMPs such as MMP-1, MMP-7, and MMP-9, rendering MMP-3 crucial in connective tissue remodeling. The enzyme is thought to be involved in wound repair, progression of atherosclerosis, and tumor initiation.
Research Category :
Angiogenesis, Atherosclerosis, Cancer, Cardiovascular, Cell Biology, Cytoskeleton / Ecm, Ecm Enzymes, Extracellular Matrix, Invasion/Microenvironment, Metalloprotease, Proteolysis / Ubiquitin, Proteolytic Enzymes, Signal Transduction, Tumor Biomarkers
company information
Boster
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
https://www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
questions and comments