This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Boster
product type :
antibody
product name :
Anti-Haptoglobin/HP Picoband Antibody
catalog :
PB9219
quantity :
100 ug/vial
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse
application :
western blot, immunohistochemistry
product information
sku :
PB9219
status :
Enabled
name :
Anti-Haptoglobin/HP Picoband Antibody
category name :
Primary Antibodies, Polyclonal Antibodies, IHC ICC IF Antibodies
gene name :
HP
price various sizes :
Unconjugated / $280 APC / $330 APC-Cy7 / $330 FITC / $330 PE / $330 PE-Cy5 / $330 PE-Cy7 / $330 30ug sample size / $99 100ug / $280 100ug+Free HRP Secondary BA1054 / $280 100ug+Free Biotin Secondary BA1003 / $280
clonality :
Polyclonal
concentration :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
conjugate :
No
contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
description :
Polyclonal antibody for HAPTOGLOBIN/HP detection. Host: Rabbit.Size: 100ug/vial. Tested applications: IHC-P. Reactive species: Human. HAPTOGLOBIN/HP information: Molecular Weight: 45205 MW; Subcellular Localization: Secreted; Tissue Specificity: Expressed by the liver and secreted in plasma.
short description :
Rabbit IgG polyclonal antibody for Haptoglobin(HP) detection. Tested with WB, IHC-P in Human;Mouse.
size :
100 ug/vial
sample size available :
30ug for $99, contact us for details
uniprot id :
P00738
host :
Rabbit
immunogen :
A synthetic peptide corresponding to a sequence in the middle region of human Haptoglobin(128-160aa NNEKQWINKAVGDKLPECEAVCGKPKNPANPVQ), different from the related mouse sequence by ten amino acids, and from the related rat sequence by nine amino acids.
form :
Lyophilized
purification :
Immunogen affinity purified.
storage :
At -20 C for one year. After reconstitution, at 4 C for one month. It can also be aliquotted and stored frozen at -20 C for a longer time.Avoid repeated freezing and thawing.
cross reactivity :
No cross reactivity with other proteins
reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
application details :
Immunohistochemistry(Paraffin-embedded Section), 0.5-1ug/ml, Human, By Heat. Western blot, 0.1-0.5ug/ml, Human, Mouse.
applications :
IHC, WB
reactivity :
Human, Mouse
image labels :
Anti- Haptoglobin antibody, PB9219, Western blotting.
All lanes: Anti Haptoglobin (PB9219) at 0.5ug/ml. WB: Recombinant Human Haptoglobin Protein 0.5ng. Predicted bind size: 38KD. Observed bind size: 38KD Anti- Haptoglobin antibody, PB9219, Western blotting. All lanes: Anti Haptoglobin (PB9219) at 0.5ug/ml. Lane 1: HELA Whole Cell Lysate at 40ug. Lane 2: SMMC Whole Cell Lysate at 40ug. Lane 3: HEPA Whole Cell Lysate at 40ug. Lane 4: HEPG2 Whole Cell Lysate at 40ug. Predicted bind size: 45KD. Observed bind size: 45KD Anti- Haptoglobin antibody, PB9219, IHC(P). IHC(P): Human Placenta Tissue
background :
Haptoglobin(HP), is a protein that in humans is encoded by the HP gene. Haptoglobin, a plasma glycoprotein that binds free hemoglobin, has a tetrameric structure of 2 alpha and 2 beta polypeptides that are covalently associated by disulfide bonds. Haptoglobin is homologous to serine proteases of the chymotrypsinogen family. A major function of haptoglobin is to bind hemoglobin(Hb) to form a stable Hp-Hb complex and thereby prevent Hb-induced oxidative tissue damage. Haptoglobin is an unusual secretory protein in that it is proteolytically processed in the endoplasmic reticulum and not in the Golgi. In clinical settings, the haptoglobulin assay is used to screen for and monitor intravascular hemolytic anemia.
competitor equivalent skus :
sc 249212 sc 249211
research category :
Tags & Cell Markers
synonyms :
Haptoglobin;Zonulin;Haptoglobin alpha chain;Haptoglobin beta chain;HP;
gene full name :
Haptoglobin
molecular weight :
45205 MW
protein function :
As a result of hemolysis, hemoglobin is found to accumulate in the kidney and is secreted in the urine. Haptoglobin captures, and combines with free plasma hemoglobin to allow hepatic recycling of heme iron and to prevent kidney damage. Haptoglobin also acts as an Antimicrobial; Antioxidant, has antibacterial activity and plays a role in modulating many aspects of the acute phase response. Hemoglobin/haptoglobin complexes are rapidely cleared by the macrophage CD163 scavenger receptor expressed on the surface of liver Kupfer cells through an endocytic lysosomal degradation pathway.
subcellular localization :
Secreted.
tissue specificity :
Expressed by the liver and secreted in plasma.
protein name :
Haptoglobin
recommended detection systems :
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).
sequence similarities :
Belongs to the peptidase S1 family.
last modified :
1/28/19 19:39
company information

Boster
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
https://www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
questions and comments